Recombinant Human PKDCC Protein, MBP&His-tagged

• Cat.No.: PKDCC-40H
• Product Overview: Recombinant Human PKDCC Protein(Q504Y2)(41-150 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 41-150 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 55 kDa
• AASequence: PSPAPGPGRRGGRGELARQIRARYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLPRPRPPWARPLSDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYMGSGYTK
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PKDCC protein kinase domain containing, cytoplasmic homolog (mouse) [ Homo sapiens ]
• Official Symbol: PKDCC
• Synonyms: PKDCC; protein kinase domain containing, cytoplasmic homolog (mouse); protein kinase domain-containing protein, cytoplasmic; SgK493; vertebrate lonesome kinase; Vlk; sugen kinase 493; protein kinase-like protein SgK493; SGK493; FLJ18197; MGC125960
• Gene ID: 91461
• mRNA Refseq: NM_138370
• Protein Refseq: NP_612379
• MIM: 614150
• UniProt ID: Q504Y2