Recombinant Human PKP1 Protein, His-tagged

• Cat.No.: PKP1-190H
• Product Overview: Recombinant Human PKP1 Protein(Q13835)(11-80 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-80 aa
• Form: Phosphate buffered saline
• Molecular Mass: 10 kDa
• AASequence: AYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSSTLSHSNRGSMYDGLADNYNY
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PKP1 plakophilin 1 (ectodermal dysplasia/skin fragility syndrome) [ Homo sapiens ]
• Official Symbol: PKP1
• Synonyms: PKP1; plakophilin 1 (ectodermal dysplasia/skin fragility syndrome); plakophilin-1; B6P; band 6 protein; MGC138829
• Gene ID: 5317
• mRNA Refseq: NM_000299
• Protein Refseq: NP_000290
• MIM: 601975
• UniProt ID: Q13835