Recombinant Human PLA2G10 protein, His-GST&Myc-tagged
| Cat.No. : | PLA2G10-307H |
| Product Overview : | Recombinant Human PLA2G10 protein(O15496)(43-165aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 43-165aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD |
| Gene Name | PLA2G10 phospholipase A2, group X [ Homo sapiens ] |
| Official Symbol | PLA2G10 |
| Synonyms | PLA2G10; phospholipase A2, group X; group 10 secretory phospholipase A2; GXPLA2; sPLA2-X; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; SPLA2; GXSPLA2; MGC119918; MGC119919; MGC133367; |
| Gene ID | 8399 |
| mRNA Refseq | NM_003561 |
| Protein Refseq | NP_003552 |
| MIM | 603603 |
| UniProt ID | O15496 |
| ◆ Recombinant Proteins | ||
| PLA2G10-30733TH | Recombinant Human PLA2G10, His-tagged | +Inquiry |
| PLA2G10-1691H | Recombinant Human PLA2G10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2G10-103HFL | Recombinant Full Length Human PLA2G10 Protein, C-Flag-tagged | +Inquiry |
| PLA2G10-70H | Recombinant Human phospholipase A2, group X, His-tagged | +Inquiry |
| Pla2g10-4894M | Recombinant Mouse Pla2g10 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G10 Products
Required fields are marked with *
My Review for All PLA2G10 Products
Required fields are marked with *



