Recombinant Human phospholipase A2, group X, His-tagged
Cat.No. : | PLA2G10-70H |
Product Overview : | Recombinant Human Secreted Phospholipase A2-Xproduced inE.Coliis manufactured with N-terminal fusion His-tagged. sPLA2-X His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues – HisTag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. |
Amino Acid Sequence : | MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRD AIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKC DQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
Physical Appearance : | Sterile Filtered lyophilized (freeze-dried) powder. |
Purification Method : | Single-step procedure using affinity Ni-NTA chromatography. |
Purity : | Greater than 95% as determined by SDS PAGE. |
Formulation : | Sterile filtered and lyophilized from 0.5 mg/ml in 0.01 M Tris buffer pH 7.2. |
Solubility : | Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely. |
Specificity : | The amino acid sequence of the recombinant human Secreted Phospholipase A2-X is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-X without signal sequence and activation peptide. |
Applications : | Western blotting. |
Stability : | Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. The lyophilized protein remains stable until the expiry date when stored at -20°C. |
Gene Name | PLA2G10 phospholipase A2, group X [ Homo sapiens ] |
Synonyms | SPLA2; GXPLA2; GXSPLA2; MGC119918; MGC119919; MGC133367; PLA2G10;Group 10 secretory phospholipase A2;EC3.1.1.4; Group X secretory phospholipase A2; GX sPLA2; Phosphatidylcholine 2-acylhydrolase GX; sPLA2-X |
Gene ID | 8399 |
mRNA Refseq | NM_003561 |
Protein Refseq | NP_003552 |
MIM | 603603 |
UniProt ID | O15496 |
Chromosome Location | 16p13.1-p12 |
Pathway | Arachidonic acid metabolism; Ether lipid metabolism; Fc epsilon RI signaling pathway; GnRH signaling pathway; Linoleic acid metabolism; Long-term depression; MAPK signaling pathway; Metabolic pathways; VEGF signaling pathway; Vascular smooth muscle contraction; alpha-Linolenic acid metabolism; Glycerophospholipid metabolism |
Function | calcium ion binding; hydrolase activity; phospholipase A2 activity |
◆ Recombinant Proteins | ||
Pla2g10-1272M | Recombinant Mouse Pla2g10 protein, His&Myc-tagged | +Inquiry |
PLA2G10-09H | Recombinant Human PLA2G10 Protein, DYKDDDDK-tagged | +Inquiry |
PLA2G10-103HFL | Recombinant Full Length Human PLA2G10 Protein, C-Flag-tagged | +Inquiry |
PLA2G10-4484R | Recombinant Rat PLA2G10 Protein | +Inquiry |
PLA2G10-4485R | Recombinant Rat PLA2G10 Protein, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G10 Products
Required fields are marked with *
My Review for All PLA2G10 Products
Required fields are marked with *
0
Inquiry Basket