Recombinant Human PLA2G2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PLA2G2A-3541H |
Product Overview : | PLA2G2A MS Standard C13 and N15-labeled recombinant protein (NP_000291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PLA2G2A phospholipase A2 group IIA [ Homo sapiens (human) ] |
Official Symbol | PLA2G2A |
Synonyms | PLA2G2A; phospholipase A2, group IIA (platelets, synovial fluid); PLA2B, PLA2L; phospholipase A2, membrane associated; NPS-PLA2; GIIC sPLA2; group IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; non-pancreatic secretory phospholipase A2; MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2; |
Gene ID | 5320 |
mRNA Refseq | NM_000300 |
Protein Refseq | NP_000291 |
MIM | 172411 |
UniProt ID | P14555 |
◆ Recombinant Proteins | ||
Pla2g2a-3880R | Recombinant Rat Pla2g2a protein, His-SUMO-tagged | +Inquiry |
Pla2g2a-8259R | Recombinant Rat Pla2g2a protein, His & GST-tagged | +Inquiry |
PLA2G2A-1582R | Recombinant Rat PLA2G2A Protein (22-146 aa), His-tagged | +Inquiry |
PLA2G2A-4923H | Recombinant Human PLA2G2A Protein (Asn21-Cys144), His tagged | +Inquiry |
PLA2G2A-1036H | Recombinant Human, PLA2G2A His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G2A-2184HCL | Recombinant Human PLA2G2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G2A Products
Required fields are marked with *
My Review for All PLA2G2A Products
Required fields are marked with *
0
Inquiry Basket