Recombinant Human PLA2G3 Protein, GST-tagged
Cat.No. : | PLA2G3-01H |
Product Overview : | Recombinant human PLA2G3 (21-130) protein with a N-terminal GST-tag was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 21-130 |
Description : | This gene encodes a protein that belongs to the secreted phospholipase A2 family, whose members include the bee venom enzyme. The encoded enzyme functions in lipid metabolism and catalyzes the calcium-dependent hydrolysis of the sn-2 acyl bond of phospholipids to release arachidonic acid and lysophospholipids. This enzyme acts as a negative regulator of ciliogenesis, and may play a role in cancer development by stimulating tumor cell growth and angiogenesis. This gene is associated with oxidative stress, and polymorphisms in this gene are linked to risk for Alzheimer's disease. |
Molecular Mass : | 37.84KDa |
AA Sequence : | SPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARK |
Applications : | AP, Array, ELISA, WB-Re |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer |
Warning : | Wash thoroughly after handling. Use with adequate ventilation. Avoid contact with eyes, skin, and clothing. Avoid ingestion and inhalation. |
Gene Name | PLA2G3 phospholipase A2 group III [ Homo sapiens (human) ] |
Official Symbol | PLA2G3 |
Synonyms | PLA2G3; phospholipase A2 group III; SPLA2III; sPLA2-III; GIII-SPLA2; group 3 secretory phospholipase A2; group III secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 3; phosphatidylcholine 2-acylhydrolase GIII |
Gene ID | 50487 |
mRNA Refseq | NM_015715 |
Protein Refseq | NP_056530 |
MIM | 611651 |
UniProt ID | Q9NZ20 |
◆ Recombinant Proteins | ||
PLA2G3-119H | Recombinant Human PLA2G3 protein, His-tagged | +Inquiry |
PLA2G3-118H | Recombinant Human PLA2G3 Protein, His-tagged | +Inquiry |
Pla2g3-8260R | Recombinant Rat Pla2g3 protein, His & T7-tagged | +Inquiry |
PLA2G3-01H | Recombinant Human PLA2G3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G3-3142HCL | Recombinant Human PLA2G3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G3 Products
Required fields are marked with *
My Review for All PLA2G3 Products
Required fields are marked with *