Recombinant Human PLA2G3 Protein, GST-tagged

• Cat.No.: PLA2G3-01H
• Product Overview: Recombinant human PLA2G3 (21-130) protein with a N-terminal GST-tag was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 21-130
• Description: This gene encodes a protein that belongs to the secreted phospholipase A2 family, whose members include the bee venom enzyme. The encoded enzyme functions in lipid metabolism and catalyzes the calcium-dependent hydrolysis of the sn-2 acyl bond of phospholipids to release arachidonic acid and lysophospholipids. This enzyme acts as a negative regulator of ciliogenesis, and may play a role in cancer development by stimulating tumor cell growth and angiogenesis. This gene is associated with oxidative stress, and polymorphisms in this gene are linked to risk for Alzheimer's disease.
• Molecular Mass: 37.84KDa
• AA Sequence: SPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARK
• Applications: AP, Array, ELISA, WB-Re
• Notes: Best use within three months from the date of receipt of this protein
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
• Warning: Wash thoroughly after handling. Use with adequate ventilation. Avoid contact with eyes, skin, and clothing. Avoid ingestion and inhalation.

Gene Information

• Gene Name: PLA2G3 phospholipase A2 group III [ Homo sapiens (human) ]
• Official Symbol: PLA2G3
• Synonyms: PLA2G3; phospholipase A2 group III; SPLA2III; sPLA2-III; GIII-SPLA2; group 3 secretory phospholipase A2; group III secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 3; phosphatidylcholine 2-acylhydrolase GIII
• Gene ID: 50487
• mRNA Refseq: NM_015715
• Protein Refseq: NP_056530
• MIM: 611651
• UniProt ID: Q9NZ20