Recombinant Human PLA2G5 Protein (21-138 aa), His-tagged
Cat.No. : | PLA2G5-1487H |
Product Overview : | Recombinant Human PLA2G5 Protein (21-138 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-138 aa |
Description : | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.6 kDa |
AA Sequence : | GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PLA2G5 phospholipase A2, group V [ Homo sapiens ] |
Official Symbol | PLA2G5 |
Synonyms | PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2); MGC46205; DKFZp686C2294; |
Gene ID | 5322 |
mRNA Refseq | NM_000929 |
Protein Refseq | NP_000920 |
MIM | 601192 |
UniProt ID | P39877 |
◆ Recombinant Proteins | ||
PLA2G5-4150R | Recombinant Rat PLA2G5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G5-4490R | Recombinant Rat PLA2G5 Protein | +Inquiry |
PLA2G5-3455R | Recombinant Rhesus monkey PLA2G5 Protein, His-tagged | +Inquiry |
PLA2G5-71H | Recombinant Human Phospholipase A2, Group V, His-tagged | +Inquiry |
PLA2G5-722R | Recombinant Rat PLA2G5 Protein (21-137 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G5 Products
Required fields are marked with *
My Review for All PLA2G5 Products
Required fields are marked with *
0
Inquiry Basket