Recombinant Human PLA2G5 Protein (21-138 aa), His-tagged

Cat.No. : PLA2G5-1487H
Product Overview : Recombinant Human PLA2G5 Protein (21-138 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 21-138 aa
Description : PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.6 kDa
AA Sequence : GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PLA2G5 phospholipase A2, group V [ Homo sapiens ]
Official Symbol PLA2G5
Synonyms PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2); MGC46205; DKFZp686C2294;
Gene ID 5322
mRNA Refseq NM_000929
Protein Refseq NP_000920
MIM 601192
UniProt ID P39877

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G5 Products

Required fields are marked with *

My Review for All PLA2G5 Products

Required fields are marked with *

0
cart-icon