Recombinant Human PLA2G5 Protein (21-138 aa), His-tagged

• Cat.No.: PLA2G5-1487H
• Product Overview: Recombinant Human PLA2G5 Protein (21-138 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 21-138 aa
• Description: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.6 kDa
• AA Sequence: GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: PLA2G5 phospholipase A2, group V [ Homo sapiens ]
• Official Symbol: PLA2G5
• Synonyms: PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2); MGC46205; DKFZp686C2294
• Gene ID: 5322
• mRNA Refseq: NM_000929
• Protein Refseq: NP_000920
• MIM: 601192
• UniProt ID: P39877