Recombinant Human PLA2G6 protein, GST-tagged

Cat.No. : PLA2G6-185H
Product Overview : Recombinant Human PLA2G6(1 a.a. - 752 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-752 a.a.
Description : The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 110.5 kDa
AA Sequence : MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLE LEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENE EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLH LACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSKDNVEMIKALIVFGAE VDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKGLIIIQLLIAIEKAS GVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRK PKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGK MVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLL SP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot(Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PLA2G6 phospholipase A2, group VI (cytosolic, calcium-independent) [ Homo sapiens ]
Official Symbol PLA2G6
Synonyms PLA2G6; phospholipase A2, group VI (cytosolic, calcium-independent); 85 kDa calcium-independent phospholipase A2; iPLA2; PARK14; PNPLA9; GVI PLA2; group VI phospholipase A2; calcium-independent phospholipase A2; patatin-like phospholipase domain containing 9; cytosolic, calcium-independent phospholipase A2; GVI; PLA2; INAD1; NBIA2A; NBIA2B; CaI-PLA2; IPLA2-VIA;
Gene ID 8398
mRNA Refseq NM_001004426
Protein Refseq NP_001004426
MIM 603604
UniProt ID O60733
Chromosome Location 22q13.1
Pathway Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem;
Function calcium-independent phospholipase A2 activity; hydrolase activity; phospholipase A2 activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G6 Products

Required fields are marked with *

My Review for All PLA2G6 Products

Required fields are marked with *

0
cart-icon