Recombinant Human PLA2G6 protein, GST-tagged
Cat.No. : | PLA2G6-185H |
Product Overview : | Recombinant Human PLA2G6(1 a.a. - 752 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-752 a.a. |
Description : | The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 110.5 kDa |
AA Sequence : | MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLE LEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENE EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLH LACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSKDNVEMIKALIVFGAE VDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKGLIIIQLLIAIEKAS GVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRK PKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGK MVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLL SP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot(Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PLA2G6 phospholipase A2, group VI (cytosolic, calcium-independent) [ Homo sapiens ] |
Official Symbol | PLA2G6 |
Synonyms | PLA2G6; phospholipase A2, group VI (cytosolic, calcium-independent); 85 kDa calcium-independent phospholipase A2; iPLA2; PARK14; PNPLA9; GVI PLA2; group VI phospholipase A2; calcium-independent phospholipase A2; patatin-like phospholipase domain containing 9; cytosolic, calcium-independent phospholipase A2; GVI; PLA2; INAD1; NBIA2A; NBIA2B; CaI-PLA2; IPLA2-VIA; |
Gene ID | 8398 |
mRNA Refseq | NM_001004426 |
Protein Refseq | NP_001004426 |
MIM | 603604 |
UniProt ID | O60733 |
Chromosome Location | 22q13.1 |
Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; |
Function | calcium-independent phospholipase A2 activity; hydrolase activity; phospholipase A2 activity; |
◆ Recombinant Proteins | ||
Pla2g6-613R | Recombinant Rat Pla2g6 Protein, His-tagged | +Inquiry |
PLA2G6-611H | Recombinant Human PLA2G6 Protein, His-tagged | +Inquiry |
PLA2G6-187H | Recombinant Human PLA2G6 protein, MYC/DDK-tagged | +Inquiry |
PLA2G6-383H | Recombinant Human PLA2G6 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Pla2g6-4903M | Recombinant Mouse Pla2g6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G6-3139HCL | Recombinant Human PLA2G6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G6 Products
Required fields are marked with *
My Review for All PLA2G6 Products
Required fields are marked with *