Recombinant Human PLAGL1
Cat.No. : | PLAGL1-31027TH |
Product Overview : | Recombinant fragment of Human PLAGL1/ZAC, isoform 2 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activities. It has been shown to have anti-proliferative properties, and thus thought to function as a tumor suppressor. In addition, overexpression of this gene during fetal development is believed to underlie the rare disorder, transient neonatal diabetes mellitus (TNDM). This gene is imprinted, with preferential expression of the paternal allele in many tissues, however, biallelic expression has been noted in peripheral blood leucocytes. A recent study reports that tissue-specific imprinting results from variable utilization of monoallelic and biallelic promoters. Many transcript variants differing in the 5 UTR and encoding two different isoforms, have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL |
Sequence Similarities : | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 7 C2H2-type zinc fingers. |
Gene Name | PLAGL1 pleiomorphic adenoma gene-like 1 [ Homo sapiens ] |
Official Symbol | PLAGL1 |
Synonyms | PLAGL1; pleiomorphic adenoma gene-like 1; zinc finger protein PLAGL1; LOT1; ZAC; |
Gene ID | 5325 |
mRNA Refseq | NM_001080951 |
Protein Refseq | NP_001074420 |
MIM | 603044 |
Uniprot ID | Q9UM63 |
Chromosome Location | 6q24-q25 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; metal ion binding; nucleic acid binding; zinc ion binding; |
◆ Recombinant Proteins | ||
PLAGL1-31027TH | Recombinant Human PLAGL1 | +Inquiry |
Plagl1-1947R | Recombinant Rat Plagl1 Protein, His-tagged | +Inquiry |
PLAGL1-3460R | Recombinant Rhesus monkey PLAGL1 Protein, His-tagged | +Inquiry |
PLAGL1-752H | Recombinant Human PLAGL1 Protein, His-tagged | +Inquiry |
PLAGL1-3278R | Recombinant Rhesus Macaque PLAGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAGL1-3133HCL | Recombinant Human PLAGL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAGL1 Products
Required fields are marked with *
My Review for All PLAGL1 Products
Required fields are marked with *