Recombinant Human PLAGL1

Cat.No. : PLAGL1-31027TH
Product Overview : Recombinant fragment of Human PLAGL1/ZAC, isoform 2 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activities. It has been shown to have anti-proliferative properties, and thus thought to function as a tumor suppressor. In addition, overexpression of this gene during fetal development is believed to underlie the rare disorder, transient neonatal diabetes mellitus (TNDM). This gene is imprinted, with preferential expression of the paternal allele in many tissues, however, biallelic expression has been noted in peripheral blood leucocytes. A recent study reports that tissue-specific imprinting results from variable utilization of monoallelic and biallelic promoters. Many transcript variants differing in the 5 UTR and encoding two different isoforms, have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL
Sequence Similarities : Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 7 C2H2-type zinc fingers.
Gene Name PLAGL1 pleiomorphic adenoma gene-like 1 [ Homo sapiens ]
Official Symbol PLAGL1
Synonyms PLAGL1; pleiomorphic adenoma gene-like 1; zinc finger protein PLAGL1; LOT1; ZAC;
Gene ID 5325
mRNA Refseq NM_001080951
Protein Refseq NP_001074420
MIM 603044
Uniprot ID Q9UM63
Chromosome Location 6q24-q25
Pathway Androgen Receptor Signaling Pathway, organism-specific biosystem;
Function DNA binding; metal ion binding; nucleic acid binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLAGL1 Products

Required fields are marked with *

My Review for All PLAGL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon