Recombinant Human platelet-derived growth factor alpha polypeptide Protein, HA tagged
Cat.No. : | PDGFA-54H |
Product Overview : | Recombinant Human PDGFA Protein (87-211aa) with N-HA tag was expressed in Yeast (animal free media and environment). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | HA |
Protein Length : | 87-196 a.a. |
Description : | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. |
Tag : | N-HA |
Form : | Lyophilized |
Molecular Mass : | 15.4 kDa |
AA Sequence : | YPYDVPDYASIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
Endotoxin : | < 0.2 EU/μg of protein as determined by the LAL method. |
Purity : | 0.95 |
Storage : | Stable for at least one year at -20 centigrade. Upon reconstitution PDGFA can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months. |
Concentration : | 120 μg/μL |
Storage Buffer : | 20 mM potassium phosphate, pH 7.0 |
Reconstitution : | Spin the vial briefly, add distilled sterile water. |
Gene Name | PDGFA platelet-derived growth factor alpha polypeptide [Homo sapiens (human)] |
Official Symbol | PDGFA |
Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A |
Gene ID | 5154 |
mRNA Refseq | NM_002607 |
Protein Refseq | NP_002598 |
MIM | 173430 |
UniProt ID | P04085 |
◆ Recombinant Proteins | ||
PDGFA-1608H | Recombinant Human PDGFA protein, GST-tagged | +Inquiry |
PDGFA-940R | Recombinant Rat PDGFA Protein (Ser87-Arg196), His-tagged | +Inquiry |
PDGFA-1609H | Recombinant Human PDGFA, GST-tagged | +Inquiry |
Pdgfa-298M | Recombinant Mouse Platelet Derived Growth Factor AA | +Inquiry |
PDGFA-2570H | Recombinant Human PDGFA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *