Recombinant Human platelet-derived growth factor alpha polypeptide Protein, HA tagged
| Cat.No. : | PDGFA-54H |
| Product Overview : | Recombinant Human PDGFA Protein (87-211aa) with N-HA tag was expressed in Yeast (animal free media and environment). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | HA |
| Protein Length : | 87-196 a.a. |
| Description : | This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. |
| Tag : | N-HA |
| Form : | Lyophilized |
| Molecular Mass : | 15.4 kDa |
| AA Sequence : | YPYDVPDYASIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
| Endotoxin : | < 0.2 EU/μg of protein as determined by the LAL method. |
| Purity : | 0.95 |
| Storage : | Stable for at least one year at -20 centigrade. Upon reconstitution PDGFA can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months. |
| Concentration : | 120 μg/μL |
| Storage Buffer : | 20 mM potassium phosphate, pH 7.0 |
| Reconstitution : | Spin the vial briefly, add distilled sterile water. |
| Gene Name | PDGFA platelet-derived growth factor alpha polypeptide [Homo sapiens (human)] |
| Official Symbol | PDGFA |
| Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A |
| Gene ID | 5154 |
| mRNA Refseq | NM_002607 |
| Protein Refseq | NP_002598 |
| MIM | 173430 |
| UniProt ID | P04085 |
| ◆ Recombinant Proteins | ||
| PDGFA-3997R | Recombinant Rat PDGFA Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pdgfa-175M | Recombinant Mouse Pdgfa protein, His/S-tagged | +Inquiry |
| PDGFA-094H | Active Recombinant Human PDGFA Protein | +Inquiry |
| PDGFA-223M | Active Recombinant Mouse PDGFA Protein | +Inquiry |
| PDGFA-57H | Recombinant Human PDGFA protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFA Products
Required fields are marked with *
My Review for All PDGFA Products
Required fields are marked with *



