Recombinant Human PLCG1 protein, GST-tagged
| Cat.No. : | PLCG1-301472H |
| Product Overview : | Recombinant Human PLCG1 (467-563 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ala467-His563 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PLCG1 phospholipase C, gamma 1 [ Homo sapiens ] |
| Official Symbol | PLCG1 |
| Synonyms | PLCG1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148) , PLC1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; NCKAP3; PLC II; PLC148; PLCgamma1; PLC-148; PLC-gamma-1; phospholipase C-II; phospholipase C-148; phosphoinositidase C; phospholipase C-gamma-1; inositoltrisphosphohydrolase; phosphoinositide phospholipase C; phosphatidylinositol phospholipase C; triphosphoinositide phosphodiesterase; phosphoinositide phospholipase C-gamma-1; monophosphatidylinositol phosphodiesterase; 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate; phospholipase C, gamma 1 (formerly subtype 148); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; PLC1; PLC-II; |
| Gene ID | 5335 |
| mRNA Refseq | NM_002660 |
| Protein Refseq | NP_002651 |
| MIM | 172420 |
| UniProt ID | P19174 |
| ◆ Recombinant Proteins | ||
| PLCG1-1703H | Recombinant Human PLCG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLCG1-334H | Recombinant Human PLCG1 Protein, His-tagged | +Inquiry |
| PLCG1-1855HFL | Recombinant Full Length Human PLCG1, Flag-tagged | +Inquiry |
| PLCG1-4505R | Recombinant Rat PLCG1 Protein | +Inquiry |
| PLCG1-94HFL | Recombinant Full Length Human PLCG1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCG1 Products
Required fields are marked with *
My Review for All PLCG1 Products
Required fields are marked with *
