Recombinant Human PLD1, GST-tagged
Cat.No. : | PLD1-27923TH |
Product Overview : | Recombinant Human PLD1(965 a.a. - 1074 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKK IRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLD1 phospholipase D1, phosphatidylcholine-specific [ Homo sapiens ] |
Official Symbol | PLD1 |
Synonyms | PLD1; phospholipase D1, phosphatidylcholine-specific; phospholipase D1; choline phosphatase 1; phospholipase D1; choline phosphatase 1; phosphatidylcholine-hydrolyzing phospholipase D1; EC 3.1.4.4 |
Gene ID | 5337 |
mRNA Refseq | NM_002662 |
Protein Refseq | NP_002653 |
MIM | 602382 |
UniProt ID | Q13393 |
Chromosome Location | 3q26 |
Pathway | Alpha-synuclein signaling; Arf6 downstream pathway; Arf6 trafficking events; CDC42 signaling events; EGFR1 Signaling Pathway |
Function | NAPE-specific phospholipase D activity; phosphatidylinositol binding; phospholipase D activity |
◆ Recombinant Proteins | ||
PLD1-1770H | Recombinant Human PLD1, GST-tagged | +Inquiry |
PLD1-4169R | Recombinant Rat PLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLD1-4932H | Recombinant Human PLD1 Protein (Thr725-Thr1074), N-His tagged | +Inquiry |
PLD1-4509R | Recombinant Rat PLD1 Protein | +Inquiry |
PLD1-27923TH | Recombinant Human PLD1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLD1-3123HCL | Recombinant Human PLD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLD1 Products
Required fields are marked with *
My Review for All PLD1 Products
Required fields are marked with *