Recombinant Human PLD1, GST-tagged

Cat.No. : PLD1-27923TH
Product Overview : Recombinant Human PLD1(965 a.a. - 1074 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties.
Molecular Mass : 37.84 kDa
AA Sequence : GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKK IRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLD1 phospholipase D1, phosphatidylcholine-specific [ Homo sapiens ]
Official Symbol PLD1
Synonyms PLD1; phospholipase D1, phosphatidylcholine-specific; phospholipase D1; choline phosphatase 1; phospholipase D1; choline phosphatase 1; phosphatidylcholine-hydrolyzing phospholipase D1; EC 3.1.4.4
Gene ID 5337
mRNA Refseq NM_002662
Protein Refseq NP_002653
MIM 602382
UniProt ID Q13393
Chromosome Location 3q26
Pathway Alpha-synuclein signaling; Arf6 downstream pathway; Arf6 trafficking events; CDC42 signaling events; EGFR1 Signaling Pathway
Function NAPE-specific phospholipase D activity; phosphatidylinositol binding; phospholipase D activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLD1 Products

Required fields are marked with *

My Review for All PLD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon