Recombinant Human PLD1, GST-tagged

• Cat.No.: PLD1-27923TH
• Product Overview: Recombinant Human PLD1(965 a.a. - 1074 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties.
• Molecular Mass: 37.84 kDa
• AA Sequence: GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKK IRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLD1 phospholipase D1, phosphatidylcholine-specific [ Homo sapiens ]
• Official Symbol: PLD1
• Synonyms: PLD1; phospholipase D1, phosphatidylcholine-specific; phospholipase D1; choline phosphatase 1; phospholipase D1; choline phosphatase 1; phosphatidylcholine-hydrolyzing phospholipase D1; EC 3.1.4.4
• Gene ID: 5337
• mRNA Refseq: NM_002662
• Protein Refseq: NP_002653
• MIM: 602382
• UniProt ID: Q13393
• Chromosome Location: 3q26
• Pathway: Alpha-synuclein signaling; Arf6 downstream pathway; Arf6 trafficking events; CDC42 signaling events; EGFR1 Signaling Pathway
• Function: NAPE-specific phospholipase D activity; phosphatidylinositol binding; phospholipase D activity