Recombinant Human PLD2 protein, His-tagged
Cat.No. : | PLD2-3039H |
Product Overview : | Recombinant Human PLD2 protein(1-141 aa), fused to His tag, was expressed in E. coli. |
Availability | August 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-141 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLD2 phospholipase D2 [ Homo sapiens ] |
Official Symbol | PLD2 |
Synonyms | PLD2; phospholipase D2; choline phosphatase 2; PLD1C; hPLD2; phosphatidylcholine-hydrolyzing phospholipase D2; |
Gene ID | 5338 |
mRNA Refseq | NM_001243108 |
Protein Refseq | NP_001230037 |
MIM | 602384 |
UniProt ID | O14939 |
◆ Recombinant Proteins | ||
PLD2-301262H | Recombinant Human PLD2 protein, GST-tagged | +Inquiry |
PLD2-383HF | Recombinant Full Length Human PLD2 Protein, GST-tagged | +Inquiry |
Pld2-4917R | Recombinant Rat Pld2 protein | +Inquiry |
PLD2-6823M | Recombinant Mouse PLD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLD2-4170R | Recombinant Rat PLD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLD2 Products
Required fields are marked with *
My Review for All PLD2 Products
Required fields are marked with *