Recombinant Human PLG protein, His-tagged
| Cat.No. : | PLG-3348H |
| Product Overview : | Recombinant Human PLG protein(P00747)(274-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 274-560aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.0 kDa |
| AA Sequence : | QCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PLG plasminogen [ Homo sapiens ] |
| Official Symbol | PLG |
| Synonyms | PLG; plasminogen; plasmin; DKFZp779M0222; |
| Gene ID | 5340 |
| mRNA Refseq | NM_001168338 |
| Protein Refseq | NP_001161810 |
| MIM | 173350 |
| UniProt ID | P00747 |
| ◆ Recombinant Proteins | ||
| PLG-66H | Recombinant Human Plasminogen | +Inquiry |
| PLG-11518Z | Recombinant Zebrafish PLG | +Inquiry |
| PLG-12970M | Recombinant Mouse PLG Protein | +Inquiry |
| PLG-134H | Recombinant Human PLG Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLG-4933H | Recombinant Human PLG Protein (Glu20-Arg580), C-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| Plg-291M | Active Native Mouse glu-Plasminogen | +Inquiry |
| PLG-30880TH | Native Human PLG | +Inquiry |
| PLG-15H | Native Human Plasminogen Protein | +Inquiry |
| Plg-1897R | Native Rat Plasminogen | +Inquiry |
| Plg-297M | Active Native Mouse Plasmin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLG-3109HCL | Recombinant Human PLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLG Products
Required fields are marked with *
My Review for All PLG Products
Required fields are marked with *



