Recombinant Human PLG protein, His-tagged
Cat.No. : | PLG-3348H |
Product Overview : | Recombinant Human PLG protein(P00747)(274-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 274-560aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.0 kDa |
AA Sequence : | QCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PLG plasminogen [ Homo sapiens ] |
Official Symbol | PLG |
Synonyms | PLG; plasminogen; plasmin; DKFZp779M0222; |
Gene ID | 5340 |
mRNA Refseq | NM_001168338 |
Protein Refseq | NP_001161810 |
MIM | 173350 |
UniProt ID | P00747 |
◆ Recombinant Proteins | ||
PLG-4186H | Active Recombinant Human Plasminogen | +Inquiry |
PLG-67H | Active Recombinant Human PLG Protein | +Inquiry |
PLG-11518Z | Recombinant Zebrafish PLG | +Inquiry |
PLG-3348H | Recombinant Human PLG protein, His-tagged | +Inquiry |
Plg-6730R | Recombinant Rat Plg protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-30083TH | Native Human PLG | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLG-3109HCL | Recombinant Human PLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLG Products
Required fields are marked with *
My Review for All PLG Products
Required fields are marked with *
0
Inquiry Basket