Recombinant Human PLIN2 protein, His-tagged
Cat.No. : | PLIN2-9448H |
Product Overview : | Recombinant Human PLIN2 protein(88-437 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 88-437 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH |
Gene Name | PLIN2 perilipin 2 [ Homo sapiens ] |
Official Symbol | PLIN2 |
Synonyms | PLIN2; perilipin 2; ADFP, adipose differentiation related protein; perilipin-2; adipophilin; ADRP; adipose differentiation-related protein; ADFP; MGC10598; |
Gene ID | 123 |
mRNA Refseq | NM_001122 |
Protein Refseq | NP_001113 |
MIM | 103195 |
UniProt ID | Q99541 |
◆ Recombinant Proteins | ||
PLIN2-3070C | Recombinant Chicken PLIN2 | +Inquiry |
PLIN2-12972M | Recombinant Mouse PLIN2 Protein | +Inquiry |
PLIN2-923HF | Recombinant Full Length Human PLIN2 Protein, GST-tagged | +Inquiry |
ADRP-3207H | Recombinant Human PLIN2 protein, His-tagged | +Inquiry |
PLIN2-904H | Recombinant Human Perilipin 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLIN2-3107HCL | Recombinant Human PLIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLIN2 Products
Required fields are marked with *
My Review for All PLIN2 Products
Required fields are marked with *