Recombinant Human PLN

Cat.No. : PLN-30732TH
Product Overview : Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 30 amino acids
Description : The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure.
Molecular Weight : 28.930kDa inclusive of tags
Tissue specificity : Heart.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEKVQYLTRSAIRRASTIEMPQQARQKLQN
Sequence Similarities : Belongs to the phospholamban family.
Gene Name PLN phospholamban [ Homo sapiens ]
Official Symbol PLN
Synonyms PLN; phospholamban; PLB; cardiac phospholamban; CMD1P;
Gene ID 5350
mRNA Refseq NM_002667
Protein Refseq NP_002658
MIM 172405
Uniprot ID P26678
Chromosome Location 6q22.1
Pathway Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function ATPase inhibitor activity; calcium channel regulator activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLN Products

Required fields are marked with *

My Review for All PLN Products

Required fields are marked with *

0
cart-icon
0
compare icon