Recombinant Human PLN
Cat.No. : | PLN-30732TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 30 amino acids |
Description : | The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. |
Molecular Weight : | 28.930kDa inclusive of tags |
Tissue specificity : | Heart. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEKVQYLTRSAIRRASTIEMPQQARQKLQN |
Sequence Similarities : | Belongs to the phospholamban family. |
Gene Name | PLN phospholamban [ Homo sapiens ] |
Official Symbol | PLN |
Synonyms | PLN; phospholamban; PLB; cardiac phospholamban; CMD1P; |
Gene ID | 5350 |
mRNA Refseq | NM_002667 |
Protein Refseq | NP_002658 |
MIM | 172405 |
Uniprot ID | P26678 |
Chromosome Location | 6q22.1 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; |
Function | ATPase inhibitor activity; calcium channel regulator activity; protein binding; |
◆ Recombinant Proteins | ||
PLN-1489H | Recombinant Human PLN Protein (1-52 aa), GST-tagged | +Inquiry |
PLN-3474R | Recombinant Rhesus monkey PLN Protein, His-tagged | +Inquiry |
PLN-12983M | Recombinant Mouse PLN Protein | +Inquiry |
PLN-4936H | Recombinant Human PLN Protein (Met1-Leu52), N-GST tagged | +Inquiry |
PLN-7947Z | Recombinant Zebrafish PLN | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLN Products
Required fields are marked with *
My Review for All PLN Products
Required fields are marked with *
0
Inquiry Basket