Recombinant Human PLSCR1
Cat.No. : | PLSCR1-30296TH |
Product Overview : | Recombinant full length Human Scramblase 1 with N terminal proprietary tag; Predicted MWt 61.09 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 318 amino acids |
Description : | Phospholipid scramblase 1 is an enzyme that in humans is encoded by the PLSCR1 gene. |
Molecular Weight : | 61.090kDa inclusive of tags |
Tissue specificity : | Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYP GPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGA AGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVL TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPF TLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPG VPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCC GDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQ FPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW |
Sequence Similarities : | Belongs to the phospholipid scramblase family. |
Gene Name | PLSCR1 phospholipid scramblase 1 [ Homo sapiens ] |
Official Symbol | PLSCR1 |
Synonyms | PLSCR1; phospholipid scramblase 1; MMTRA1B; |
Gene ID | 5359 |
mRNA Refseq | NM_021105 |
Protein Refseq | NP_066928 |
MIM | 604170 |
Uniprot ID | O15162 |
Chromosome Location | 3q23 |
Pathway | EGFR1 Signaling Pathway, organism-specific biosystem; |
Function | CD4 receptor binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; SH3 domain binding; calcium ion binding; calcium ion binding; |
◆ Recombinant Proteins | ||
PLSCR1-354H | Recombinant Human phospholipid scramblase 1, His-tagged | +Inquiry |
PLSCR1-1788H | Recombinant Human PLSCR1 protein, His & T7-tagged | +Inquiry |
PLSCR1-6859M | Recombinant Mouse PLSCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28163RF | Recombinant Full Length Rat Phospholipid Scramblase 1(Plscr1) Protein, His-Tagged | +Inquiry |
PLSCR1-4938H | Recombinant Human PLSCR1 Protein (Met1-Trp318), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLSCR1-3096HCL | Recombinant Human PLSCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLSCR1 Products
Required fields are marked with *
My Review for All PLSCR1 Products
Required fields are marked with *
0
Inquiry Basket