Recombinant Human PNP protein(11-280 aa), C-His-tagged
| Cat.No. : | PNP-2498H | 
| Product Overview : | Recombinant Human PNP protein(P00491)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 11-280 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKA | 
| Gene Name | PNP purine nucleoside phosphorylase [ Homo sapiens ] | 
| Official Symbol | PNP | 
| Synonyms | PNP; purine nucleoside phosphorylase; NP, nucleoside phosphorylase; PUNP; inosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; NP; PRO1837; FLJ94043; FLJ97288; FLJ97312; MGC117396; MGC125915; MGC125916; | 
| Gene ID | 4860 | 
| mRNA Refseq | NM_000270 | 
| Protein Refseq | NP_000261 | 
| MIM | 164050 | 
| UniProt ID | P00491 | 
| ◆ Recombinant Proteins | ||
| Pnp-7995R | Recombinant Rat Pnp protein, His & T7-tagged | +Inquiry | 
| Pnp-7994M | Recombinant Mouse Pnp protein, His & T7-tagged | +Inquiry | 
| PNP-3312R | Recombinant Rhesus Macaque PNP Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PNP-4724H | Recombinant Human PNP Protein (Met1-Ser289), N-His tagged | +Inquiry | 
| PNP-13039M | Recombinant Mouse PNP Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNP Products
Required fields are marked with *
My Review for All PNP Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            