Recombinant Human PNP protein, His-SUMO-tagged

• Cat.No.: PNP-4090H
• Product Overview: Recombinant Human PNP protein(P00491)(1-289aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-289aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.1 kDa
• AA Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PNP purine nucleoside phosphorylase [ Homo sapiens ]
• Official Symbol: PNP
• Synonyms: PNP; purine nucleoside phosphorylase; NP, nucleoside phosphorylase; PUNP; inosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; NP; PRO1837; FLJ94043; FLJ97288; FLJ97312; MGC117396; MGC125915; MGC125916
• Gene ID: 4860
• mRNA Refseq: NM_000270
• Protein Refseq: NP_000261
• MIM: 164050
• UniProt ID: P00491