Recombinant Human PNPLA3 protein, GST-tagged
| Cat.No. : | PNPLA3-1819H |
| Product Overview : | Recombinant Human PNPLA3 protein(229-339 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 229-339 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PNPLA3 patatin-like phospholipase domain containing 3 [ Homo sapiens ] |
| Official Symbol | PNPLA3 |
| Synonyms | PNPLA3; patatin-like phospholipase domain containing 3; adiponutrin , ADPN, C22orf20, chromosome 22 open reading frame 20; patatin-like phospholipase domain-containing protein 3; adiponutrin; dJ796I17.1; FLJ22012; iPLA2-epsilon; acylglycerol O-acyltransferase; calcium-independent phospholipase A2-epsilon; ADPN; C22orf20; iPLA(2)epsilon; |
| Gene ID | 80339 |
| mRNA Refseq | NM_025225 |
| Protein Refseq | NP_079501 |
| MIM | 609567 |
| UniProt ID | Q9NST1 |
| ◆ Recombinant Proteins | ||
| PNPLA3-26HFL | Recombinant Full Length Human PNPLA3 Protein, C-Flag-tagged | +Inquiry |
| PNPLA3-922HF | Recombinant Full Length Human PNPLA3 Protein, GST-tagged | +Inquiry |
| PNPLA3-1819H | Recombinant Human PNPLA3 protein, GST-tagged | +Inquiry |
| PNPLA3-487Z | Recombinant Zebrafish PNPLA3 | +Inquiry |
| PNPLA3-1725H | Recombinant Human PNPLA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PNPLA3-3068HCL | Recombinant Human PNPLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *
