Recombinant Human PNPLA3 protein, GST-tagged

Cat.No. : PNPLA3-1819H
Product Overview : Recombinant Human PNPLA3 protein(229-339 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability November 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 229-339 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name PNPLA3 patatin-like phospholipase domain containing 3 [ Homo sapiens ]
Official Symbol PNPLA3
Synonyms PNPLA3; patatin-like phospholipase domain containing 3; adiponutrin , ADPN, C22orf20, chromosome 22 open reading frame 20; patatin-like phospholipase domain-containing protein 3; adiponutrin; dJ796I17.1; FLJ22012; iPLA2-epsilon; acylglycerol O-acyltransferase; calcium-independent phospholipase A2-epsilon; ADPN; C22orf20; iPLA(2)epsilon;
Gene ID 80339
mRNA Refseq NM_025225
Protein Refseq NP_079501
MIM 609567
UniProt ID Q9NST1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNPLA3 Products

Required fields are marked with *

My Review for All PNPLA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon