Recombinant Human PNPLA3 protein, His-tagged

Cat.No. : PNPLA3-1820H
Product Overview : Recombinant Human PNPLA3(229-339aa) protein was fused to His-tag and expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111
Description : The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.
Form : Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5% trehalose and 5% mannitol are added as protectants before lyophilization.
Molecular Mass : 18 kDa
AA Sequence : PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months. Avoid repeat freeze-thaw cycles.
Reconstitution : Buffer containing 50% glycerol is recommended for reconstitution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name PNPLA3
Official Symbol PNPLA3
Synonyms ADPN; C22orf20; iPLA(2)epsilon
Gene ID 80339
mRNA Refseq NM_025225.3
Protein Refseq NP_079501.2
MIM 609567
UniProt ID Q9NST1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNPLA3 Products

Required fields are marked with *

My Review for All PNPLA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon