Recombinant Human PNPLA3 protein, His-tagged
Cat.No. : | PNPLA3-1820H |
Product Overview : | Recombinant Human PNPLA3(229-339aa) protein was fused to His-tag and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111 |
Description : | The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. |
Form : | Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 18 kDa |
AA Sequence : | PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Buffer containing 50% glycerol is recommended for reconstitution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | PNPLA3 |
Official Symbol | PNPLA3 |
Synonyms | ADPN; C22orf20; iPLA(2)epsilon |
Gene ID | 80339 |
mRNA Refseq | NM_025225.3 |
Protein Refseq | NP_079501.2 |
MIM | 609567 |
UniProt ID | Q9NST1 |
◆ Recombinant Proteins | ||
PNPLA3-1818H | Recombinant Human PNPLA3, GST-tagged | +Inquiry |
PNPLA3-1819H | Recombinant Human PNPLA3 protein, GST-tagged | +Inquiry |
PNPLA3-27H | Recombinant Human PNPLA3 Protein (I148M Mutation), GST tagged | +Inquiry |
PNPLA3-091H | Recombinant Human PNPLA3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PNPLA3-487Z | Recombinant Zebrafish PNPLA3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPLA3-3068HCL | Recombinant Human PNPLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *