Recombinant Human PNPLA8 protein, His-tagged

Cat.No. : PNPLA8-2904H
Product Overview : Recombinant Human PNPLA8 protein(100-359 aa), fused to His tag, was expressed in E. coli.
Availability September 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 100-359 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSI
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PNPLA8 patatin-like phospholipase domain containing 8 [ Homo sapiens ]
Official Symbol PNPLA8
Synonyms PNPLA8; patatin-like phospholipase domain containing 8; calcium-independent phospholipase A2-gamma; IPLA2(GAMMA); IPLA2 2; IPLA2G; PNPLA-gamma; iPLA2 gamma; iPLA2-gamma; patatin-like phospholipase domain-containing protein 8; membrane-associated calcium-independent phospholipase A2 gamma; intracellular membrane-associated calcium-independent phospholipase A2 gamma; IPLA2-2;
Gene ID 50640
mRNA Refseq NM_001256007
Protein Refseq NP_001242936
MIM 612123
UniProt ID Q9NP80

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNPLA8 Products

Required fields are marked with *

My Review for All PNPLA8 Products

Required fields are marked with *

0
cart-icon