Recombinant Human PNPLA8 protein, His-tagged
| Cat.No. : | PNPLA8-2904H |
| Product Overview : | Recombinant Human PNPLA8 protein(100-359 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 100-359 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PNPLA8 patatin-like phospholipase domain containing 8 [ Homo sapiens ] |
| Official Symbol | PNPLA8 |
| Synonyms | PNPLA8; patatin-like phospholipase domain containing 8; calcium-independent phospholipase A2-gamma; IPLA2(GAMMA); IPLA2 2; IPLA2G; PNPLA-gamma; iPLA2 gamma; iPLA2-gamma; patatin-like phospholipase domain-containing protein 8; membrane-associated calcium-independent phospholipase A2 gamma; intracellular membrane-associated calcium-independent phospholipase A2 gamma; IPLA2-2; |
| Gene ID | 50640 |
| mRNA Refseq | NM_001256007 |
| Protein Refseq | NP_001242936 |
| MIM | 612123 |
| UniProt ID | Q9NP80 |
| ◆ Recombinant Proteins | ||
| PNPLA8-3496R | Recombinant Rhesus monkey PNPLA8 Protein, His-tagged | +Inquiry |
| PNPLA8-6892M | Recombinant Mouse PNPLA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PNPLA8-3314R | Recombinant Rhesus Macaque PNPLA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PNPLA8-13047M | Recombinant Mouse PNPLA8 Protein | +Inquiry |
| RFL7645HF | Recombinant Full Length Human Calcium-Independent Phospholipase A2-Gamma(Pnpla8) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA8 Products
Required fields are marked with *
My Review for All PNPLA8 Products
Required fields are marked with *
