Recombinant Human PNPO, His-tagged
Cat.No. : | PNPO-27512TH |
Product Overview : | Recombinant fragment corresponding to amino acids 57-261 of Human PNPO with an N terminal His tag; 226 amino acids with tag, Predicted MWt 25.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 205 amino acids |
Description : | The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. |
Conjugation : | HIS |
Molecular Weight : | 25.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
Sequence Similarities : | Belongs to the pyridoxamine 5-phosphate oxidase family. |
Gene Name | PNPO pyridoxamine 5-phosphate oxidase [ Homo sapiens ] |
Official Symbol | PNPO |
Synonyms | PNPO; pyridoxamine 5-phosphate oxidase; pyridoxine 5 phosphate oxidase; pyridoxine-5-phosphate oxidase; PDXPO; |
Gene ID | 55163 |
mRNA Refseq | NM_018129 |
Protein Refseq | NP_060599 |
MIM | 603287 |
Uniprot ID | Q9NVS9 |
Chromosome Location | 17q21.32 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Selenium Pathway, organism-specific biosystem; |
Function | FMN binding; oxidoreductase activity, acting on the CH-NH2 group of donors; pyridoxamine-phosphate oxidase activity; |
◆ Recombinant Proteins | ||
PNPO-3497R | Recombinant Rhesus monkey PNPO Protein, His-tagged | +Inquiry |
PNPO-3315R | Recombinant Rhesus Macaque PNPO Protein, His (Fc)-Avi-tagged | +Inquiry |
PNPO-8118Z | Recombinant Zebrafish PNPO | +Inquiry |
PNPO-4553R | Recombinant Rat PNPO Protein | +Inquiry |
PNPO-6695H | Recombinant Human PNPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPO-3065HCL | Recombinant Human PNPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPO Products
Required fields are marked with *
My Review for All PNPO Products
Required fields are marked with *
0
Inquiry Basket