Recombinant Human PNPO, His-tagged

Cat.No. : PNPO-27512TH
Product Overview : Recombinant fragment corresponding to amino acids 57-261 of Human PNPO with an N terminal His tag; 226 amino acids with tag, Predicted MWt 25.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 205 amino acids
Description : The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy.
Conjugation : HIS
Molecular Weight : 25.900kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM PMSF, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Sequence Similarities : Belongs to the pyridoxamine 5-phosphate oxidase family.
Gene Name PNPO pyridoxamine 5-phosphate oxidase [ Homo sapiens ]
Official Symbol PNPO
Synonyms PNPO; pyridoxamine 5-phosphate oxidase; pyridoxine 5 phosphate oxidase; pyridoxine-5-phosphate oxidase; PDXPO;
Gene ID 55163
mRNA Refseq NM_018129
Protein Refseq NP_060599
MIM 603287
Uniprot ID Q9NVS9
Chromosome Location 17q21.32
Pathway Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Selenium Pathway, organism-specific biosystem;
Function FMN binding; oxidoreductase activity, acting on the CH-NH2 group of donors; pyridoxamine-phosphate oxidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNPO Products

Required fields are marked with *

My Review for All PNPO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon