Recombinant Human PODXL Protein (32-458 aa), His-tagged
Cat.No. : | PODXL-1640H |
Product Overview : | Recombinant Human PODXL Protein (32-458 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 32-458 aa |
Description : | Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma mbrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.2 kDa |
AA Sequence : | QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PODXL podocalyxin-like [ Homo sapiens ] |
Official Symbol | PODXL |
Synonyms | PODXL; podocalyxin-like; podocalyxin; Gp200; PC; PCLP; GCTM-2 antigen; podocalyxin-like protein 1; PCLP-1; MGC138240; |
Gene ID | 5420 |
mRNA Refseq | NM_001018111 |
Protein Refseq | NP_001018121 |
MIM | 602632 |
UniProt ID | O00592 |
◆ Recombinant Proteins | ||
PODXL-4217R | Recombinant Rat PODXL Protein, His (Fc)-Avi-tagged | +Inquiry |
Podxl-5829R | Recombinant Rat Podxl protein, His-tagged | +Inquiry |
PODXL-0402H | Recombinant Human PODXL protein, His-tagged | +Inquiry |
Podxl-1956M | Recombinant Mouse Podxl Protein, His-tagged | +Inquiry |
Podxl-4977M | Recombinant Mouse Podxl Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PODXL-3059HCL | Recombinant Human PODXL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PODXL Products
Required fields are marked with *
My Review for All PODXL Products
Required fields are marked with *
0
Inquiry Basket