Recombinant Human PODXL protein, His-tagged
| Cat.No. : | PODXL-0402H |
| Product Overview : | Recombinant Human PODXL protein(23-428 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-428 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PODXL podocalyxin-like [ Homo sapiens ] |
| Official Symbol | PODXL |
| Synonyms | PODXL; podocalyxin-like; podocalyxin; Gp200; PC; PCLP; GCTM-2 antigen; podocalyxin-like protein 1; PCLP-1; MGC138240; |
| Gene ID | 5420 |
| mRNA Refseq | NM_001018111 |
| Protein Refseq | NP_001018121 |
| MIM | 602632 |
| UniProt ID | O00592 |
| ◆ Recombinant Proteins | ||
| PODXL-063H | Recombinant Human PODXL Protein, DDK/HIS-tagged | +Inquiry |
| PODXL-218H | Active Recombinant Human PODXL protein, His-tagged | +Inquiry |
| PODXL-4322H | Recombinant Human PODXL protein, His-tagged | +Inquiry |
| Podxl-1957R | Recombinant Rat Podxl Protein, His-tagged | +Inquiry |
| PODXL-3885H | Recombinant Human PODXL Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PODXL-3059HCL | Recombinant Human PODXL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PODXL Products
Required fields are marked with *
My Review for All PODXL Products
Required fields are marked with *
