Recombinant Human PODXL protein, His-tagged
| Cat.No. : | PODXL-4322H |
| Product Overview : | Recombinant Human PODXL protein(O00592)(32-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 32-458aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.2 kDa |
| AA Sequence : | QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PODXL podocalyxin-like [ Homo sapiens ] |
| Official Symbol | PODXL |
| Synonyms | PODXL; podocalyxin-like; podocalyxin; Gp200; PC; PCLP; GCTM-2 antigen; podocalyxin-like protein 1; PCLP-1; MGC138240; |
| Gene ID | 5420 |
| mRNA Refseq | NM_001018111 |
| Protein Refseq | NP_001018121 |
| MIM | 602632 |
| UniProt ID | O00592 |
| ◆ Recombinant Proteins | ||
| PODXL-218H | Active Recombinant Human PODXL protein, His-tagged | +Inquiry |
| PODXL-0402H | Recombinant Human PODXL protein, His-tagged | +Inquiry |
| PODXL-32H | Recombinant Human PODXL protein, MYC/DDK-tagged | +Inquiry |
| Podxl-31M | Recombinant Mouse Podxl Protein, His-tagged | +Inquiry |
| PODXL-1640H | Recombinant Human PODXL Protein (32-458 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PODXL-3059HCL | Recombinant Human PODXL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PODXL Products
Required fields are marked with *
My Review for All PODXL Products
Required fields are marked with *



