Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POFUT1-5152H |
Product Overview : | POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
Molecular Mass : | 43.96 kDa |
AA Sequence : | MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POFUT1 protein O-fucosyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | POFUT1 |
Synonyms | POFUT1; protein O-fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; FUT12; KIAA0180; O Fuc T; O FUT; o-fucosyltransferase protein; peptide-O-fucosyltransferase 1; O-FUT; O-Fuc-T; O-FucT-1; MGC2482; |
Gene ID | 23509 |
mRNA Refseq | NM_015352 |
Protein Refseq | NP_056167 |
MIM | 607491 |
UniProt ID | Q9H488 |
◆ Recombinant Proteins | ||
POFUT1-5152H | Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POFUT1-7213H | Recombinant Human POFUT1, His-tagged | +Inquiry |
Pofut1-986M | Recombinant Mouse Pofut1 Protein, MYC/DDK-tagged | +Inquiry |
POFUT1-11738Z | Recombinant Zebrafish POFUT1 | +Inquiry |
POFUT1-5997C | Recombinant Chicken POFUT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
POFUT1-3057HCL | Recombinant Human POFUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POFUT1 Products
Required fields are marked with *
My Review for All POFUT1 Products
Required fields are marked with *
0
Inquiry Basket