Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | POFUT1-5152H |
| Product Overview : | POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. |
| Molecular Mass : | 43.96 kDa |
| AA Sequence : | MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | POFUT1 protein O-fucosyltransferase 1 [ Homo sapiens (human) ] |
| Official Symbol | POFUT1 |
| Synonyms | POFUT1; protein O-fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; FUT12; KIAA0180; O Fuc T; O FUT; o-fucosyltransferase protein; peptide-O-fucosyltransferase 1; O-FUT; O-Fuc-T; O-FucT-1; MGC2482; |
| Gene ID | 23509 |
| mRNA Refseq | NM_015352 |
| Protein Refseq | NP_056167 |
| MIM | 607491 |
| UniProt ID | Q9H488 |
| ◆ Recombinant Proteins | ||
| Pofut1-207M | Recombinant Mouse Pofut1 Protein, His-tagged | +Inquiry |
| POFUT1-5997C | Recombinant Chicken POFUT1 | +Inquiry |
| POFUT1-4558R | Recombinant Rat POFUT1 Protein | +Inquiry |
| POFUT1-4218R | Recombinant Rat POFUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| POFUT1-5152H | Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POFUT1-3057HCL | Recombinant Human POFUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POFUT1 Products
Required fields are marked with *
My Review for All POFUT1 Products
Required fields are marked with *
