Recombinant Human POFUT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POFUT1-5152H
Product Overview : POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Molecular Mass : 43.96 kDa
AA Sequence : MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POFUT1 protein O-fucosyltransferase 1 [ Homo sapiens (human) ]
Official Symbol POFUT1
Synonyms POFUT1; protein O-fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; FUT12; KIAA0180; O Fuc T; O FUT; o-fucosyltransferase protein; peptide-O-fucosyltransferase 1; O-FUT; O-Fuc-T; O-FucT-1; MGC2482;
Gene ID 23509
mRNA Refseq NM_015352
Protein Refseq NP_056167
MIM 607491
UniProt ID Q9H488

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POFUT1 Products

Required fields are marked with *

My Review for All POFUT1 Products

Required fields are marked with *

0
cart-icon