Recombinant Human POLD4 protein, GST-tagged
| Cat.No. : | POLD4-301200H |
| Product Overview : | Recombinant Human POLD4 (1-34 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Leu34 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | POLD4 polymerase (DNA-directed), delta 4 [ Homo sapiens ] |
| Official Symbol | POLD4 |
| Synonyms | POLD4; polymerase (DNA-directed), delta 4; DNA polymerase delta subunit 4; DNA polymerase delta smallest subunit p12; p12; POLDS; |
| Gene ID | 57804 |
| mRNA Refseq | NM_001256870 |
| Protein Refseq | NP_001243799 |
| MIM | 611525 |
| UniProt ID | Q9HCU8 |
| ◆ Recombinant Proteins | ||
| Pold4-4984M | Recombinant Mouse Pold4 Protein, Myc/DDK-tagged | +Inquiry |
| POLD4-3505R | Recombinant Rhesus monkey POLD4 Protein, His-tagged | +Inquiry |
| POLD4-3323R | Recombinant Rhesus Macaque POLD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLD4-5944H | Recombinant Human POLD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| POLD4-2282H | Recombinant Human POLD4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLD4-3051HCL | Recombinant Human POLD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLD4 Products
Required fields are marked with *
My Review for All POLD4 Products
Required fields are marked with *
