Recombinant Human POLD4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POLD4-5944H |
Product Overview : | POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POLD4 DNA polymerase delta 4, accessory subunit [ Homo sapiens (human) ] |
Official Symbol | POLD4 |
Synonyms | POLD4; polymerase (DNA-directed), delta 4; DNA polymerase delta subunit 4; DNA polymerase delta smallest subunit p12; p12; POLDS; |
Gene ID | 57804 |
mRNA Refseq | NM_021173 |
Protein Refseq | NP_066996 |
MIM | 611525 |
UniProt ID | Q9HCU8 |
◆ Recombinant Proteins | ||
POLD4-5944H | Recombinant Human POLD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Pold4-4984M | Recombinant Mouse Pold4 Protein, Myc/DDK-tagged | +Inquiry |
POLD4-301200H | Recombinant Human POLD4 protein, GST-tagged | +Inquiry |
POLD4-3323R | Recombinant Rhesus Macaque POLD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
POLD4-2282H | Recombinant Human POLD4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLD4-3051HCL | Recombinant Human POLD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLD4 Products
Required fields are marked with *
My Review for All POLD4 Products
Required fields are marked with *