Recombinant Human POLR1C, His-tagged
| Cat.No. : | POLR1C-28614TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-174 of Human POLR1C with N terminal His tag; MWt 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-174 a.a. |
| Description : | The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS). |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 128 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAW DQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRR ILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIH ADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAK DSSDPNELYVNHKVYTRHMT |
| Gene Name | POLR1C polymerase (RNA) I polypeptide C, 30kDa [ Homo sapiens ] |
| Official Symbol | POLR1C |
| Synonyms | POLR1C; polymerase (RNA) I polypeptide C, 30kDa; DNA-directed RNA polymerases I and III subunit RPAC1; RPA5; RPA39; RPA40; RPAC1; |
| Gene ID | 9533 |
| mRNA Refseq | NM_203290 |
| Protein Refseq | NP_976035 |
| MIM | 610060 |
| Uniprot ID | O15160 |
| Chromosome Location | 6p21.1 |
| Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
| Function | DNA binding; DNA-directed RNA polymerase activity; protein dimerization activity; |
| ◆ Recombinant Proteins | ||
| POLR1C-13088M | Recombinant Mouse POLR1C Protein | +Inquiry |
| POLR1C-1838H | Recombinant Human POLR1C, GST-tagged | +Inquiry |
| POLR1C-5010C | Recombinant Chicken POLR1C | +Inquiry |
| POLR1C-28614TH | Recombinant Human POLR1C, His-tagged | +Inquiry |
| POLR1C-5009C | Recombinant Chicken POLR1C | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR1C-3041HCL | Recombinant Human POLR1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR1C Products
Required fields are marked with *
My Review for All POLR1C Products
Required fields are marked with *
