Recombinant Human POLR1C, His-tagged
Cat.No. : | POLR1C-28614TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-174 of Human POLR1C with N terminal His tag; MWt 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-174 a.a. |
Description : | The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS). |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 128 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAW DQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRR ILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIH ADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAK DSSDPNELYVNHKVYTRHMT |
Gene Name | POLR1C polymerase (RNA) I polypeptide C, 30kDa [ Homo sapiens ] |
Official Symbol | POLR1C |
Synonyms | POLR1C; polymerase (RNA) I polypeptide C, 30kDa; DNA-directed RNA polymerases I and III subunit RPAC1; RPA5; RPA39; RPA40; RPAC1; |
Gene ID | 9533 |
mRNA Refseq | NM_203290 |
Protein Refseq | NP_976035 |
MIM | 610060 |
Uniprot ID | O15160 |
Chromosome Location | 6p21.1 |
Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; |
Function | DNA binding; DNA-directed RNA polymerase activity; protein dimerization activity; |
◆ Recombinant Proteins | ||
POLR1C-1838H | Recombinant Human POLR1C, GST-tagged | +Inquiry |
POLR1C-5009C | Recombinant Chicken POLR1C | +Inquiry |
POLR1C-10846Z | Recombinant Zebrafish POLR1C | +Inquiry |
POLR1C-5010C | Recombinant Chicken POLR1C | +Inquiry |
POLR1C-2762H | Recombinant Human POLR1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR1C-3041HCL | Recombinant Human POLR1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POLR1C Products
Required fields are marked with *
My Review for All POLR1C Products
Required fields are marked with *
0
Inquiry Basket