Recombinant Human POLR1C, His-tagged

Cat.No. : POLR1C-28614TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-174 of Human POLR1C with N terminal His tag; MWt 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-174 a.a.
Description : The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS).
Conjugation : HIS
Form : Lyophilised:Reconstitute with 128 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAW DQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRR ILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIH ADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAK DSSDPNELYVNHKVYTRHMT
Gene Name POLR1C polymerase (RNA) I polypeptide C, 30kDa [ Homo sapiens ]
Official Symbol POLR1C
Synonyms POLR1C; polymerase (RNA) I polypeptide C, 30kDa; DNA-directed RNA polymerases I and III subunit RPAC1; RPA5; RPA39; RPA40; RPAC1;
Gene ID 9533
mRNA Refseq NM_203290
Protein Refseq NP_976035
MIM 610060
Uniprot ID O15160
Chromosome Location 6p21.1
Pathway Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function DNA binding; DNA-directed RNA polymerase activity; protein dimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR1C Products

Required fields are marked with *

My Review for All POLR1C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon