Recombinant Human POLR2A protein, His-tagged

Cat.No. : POLR2A-10H
Product Overview : Recombinant Human POLR2A protein(P24928)(Ile1231-Lys1350), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ile1231-Lys1350
Form : 0.15 M Phosphate buffered saline, pH 7.4
Molecular Mass : 17 kDa
Storage : -20°C or lower, for long term storage.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK
Gene Name POLR2A polymerase (RNA) II (DNA directed) polypeptide A, 220kDa [ Homo sapiens ]
Official Symbol POLR2A
Synonyms POLR2A; polymerase (RNA) II (DNA directed) polypeptide A, 220kDa; POLR2, polymerase (RNA) II (DNA directed) polypeptide A (220kD); DNA-directed RNA polymerase II subunit RPB1; POLRA; RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; RNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kd subunit; RPO2; POLR2; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220; MGC75453;
Gene ID 5430
mRNA Refseq NM_000937
Protein Refseq NP_000928
UniProt ID P24928

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2A Products

Required fields are marked with *

My Review for All POLR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon