Recombinant Human POLR2A protein, His-tagged
| Cat.No. : | POLR2A-10H |
| Product Overview : | Recombinant Human POLR2A protein(P24928)(Ile1231-Lys1350), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ile1231-Lys1350 |
| Form : | 0.15 M Phosphate buffered saline, pH 7.4 |
| Molecular Mass : | 17 kDa |
| Storage : | -20°C or lower, for long term storage. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | IAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEK |
| Gene Name | POLR2A polymerase (RNA) II (DNA directed) polypeptide A, 220kDa [ Homo sapiens ] |
| Official Symbol | POLR2A |
| Synonyms | POLR2A; polymerase (RNA) II (DNA directed) polypeptide A, 220kDa; POLR2, polymerase (RNA) II (DNA directed) polypeptide A (220kD); DNA-directed RNA polymerase II subunit RPB1; POLRA; RPB1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II subunit A; RNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kd subunit; RPO2; POLR2; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220; MGC75453; |
| Gene ID | 5430 |
| mRNA Refseq | NM_000937 |
| Protein Refseq | NP_000928 |
| UniProt ID | P24928 |
| ◆ Recombinant Proteins | ||
| POLR2A-29986TH | Recombinant Human POLR2A, His-tagged | +Inquiry |
| POLR2A-13091M | Recombinant Mouse POLR2A Protein | +Inquiry |
| POLR2A-8461H | Active Recombinant Human POLR2A, His-tagged | +Inquiry |
| POLR2A-6920M | Recombinant Mouse POLR2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2A-2513H | Active Recombinant Human POLR2A, CT Domain, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR2A-3037HCL | Recombinant Human POLR2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2A Products
Required fields are marked with *
My Review for All POLR2A Products
Required fields are marked with *
