Recombinant Human POLR3A protein, His-tagged

Cat.No. : POLR3A-5353H
Product Overview : Recombinant Human POLR3A protein(O14802)(392-632aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 392-632aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC
Gene Name POLR3A polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [ Homo sapiens ]
Official Symbol POLR3A
Synonyms POLR3A; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; DNA-directed RNA polymerase III subunit RPC1; hRPC155; RPC1; RPC155; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit RPC155-D; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III largest subunit; ADDH; HLD7;
Gene ID 11128
mRNA Refseq NM_007055
Protein Refseq NP_008986
MIM 614258
UniProt ID O14802

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR3A Products

Required fields are marked with *

My Review for All POLR3A Products

Required fields are marked with *

0
cart-icon