Recombinant Human POLR3A protein, His-tagged
| Cat.No. : | POLR3A-5353H |
| Product Overview : | Recombinant Human POLR3A protein(O14802)(392-632aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 392-632aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC |
| Gene Name | POLR3A polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [ Homo sapiens ] |
| Official Symbol | POLR3A |
| Synonyms | POLR3A; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; DNA-directed RNA polymerase III subunit RPC1; hRPC155; RPC1; RPC155; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit RPC155-D; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III largest subunit; ADDH; HLD7; |
| Gene ID | 11128 |
| mRNA Refseq | NM_007055 |
| Protein Refseq | NP_008986 |
| MIM | 614258 |
| UniProt ID | O14802 |
| ◆ Recombinant Proteins | ||
| POLR3A-8286Z | Recombinant Zebrafish POLR3A | +Inquiry |
| POLR3A-5353H | Recombinant Human POLR3A protein, His-tagged | +Inquiry |
| POLR3A-730H | Recombinant Human POLR3A Protein (392-632 aa), His-SUMO-tagged | +Inquiry |
| POLR3A-1639C | Recombinant Chicken POLR3A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR3A Products
Required fields are marked with *
My Review for All POLR3A Products
Required fields are marked with *
