Recombinant Human POMP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POMP-2275H |
Product Overview : | POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POMP proteasome maturation protein [ Homo sapiens (human) ] |
Official Symbol | POMP |
Synonyms | POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110; |
Gene ID | 51371 |
mRNA Refseq | NM_015932 |
Protein Refseq | NP_057016 |
MIM | 613386 |
UniProt ID | Q9Y244 |
◆ Recombinant Proteins | ||
POMP-13119M | Recombinant Mouse POMP Protein | +Inquiry |
POMP-4834H | Recombinant Human POMP Protein (Met1-Leu141), N-His tagged | +Inquiry |
POMP-2275H | Recombinant Human POMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POMP-1771HF | Recombinant Full Length Human POMP Protein, GST-tagged | +Inquiry |
Pomp-5012M | Recombinant Mouse Pomp Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POMP-3017HCL | Recombinant Human POMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POMP Products
Required fields are marked with *
My Review for All POMP Products
Required fields are marked with *
0
Inquiry Basket