Recombinant Human POTEH Protein, GST-tagged
Cat.No. : | POTEH-213H |
Product Overview : | Human ACTBL1 partial ORF ( NP_001004053, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | POTEH (POTE Ankyrin Domain Family Member H) is a Protein Coding gene. An important paralog of this gene is POTEM. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VPRKDLIVMLKDTDMNKKDKQKRTALHLASANGNSEVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGNTALHYAIYNED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | POTEH POTE ankyrin domain family, member H [ Homo sapiens ] |
Official Symbol | POTEH |
Synonyms | POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1; |
Gene ID | 23784 |
mRNA Refseq | NM_001136213 |
Protein Refseq | NP_001129685 |
MIM | 608913 |
UniProt ID | Q6S545 |
◆ Recombinant Proteins | ||
POTEH-301256H | Recombinant Human POTEH protein, GST-tagged | +Inquiry |
POTEH-213H | Recombinant Human POTEH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POTEH-21HCL | Recombinant Human POTEH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POTEH Products
Required fields are marked with *
My Review for All POTEH Products
Required fields are marked with *
0
Inquiry Basket