Recombinant Human POTEH protein, GST-tagged

• Cat.No.: POTEH-301256H
• Product Overview: Recombinant Human POTEH protein(24-59 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 24-59 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: POTEH POTE ankyrin domain family, member H [ Homo sapiens ]
• Official Symbol: POTEH
• Synonyms: POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1
• Gene ID: 23784
• mRNA Refseq: NM_001136213
• Protein Refseq: NP_001129685
• MIM: 608913
• UniProt ID: Q6S545