Recombinant Human POTEH protein, GST-tagged
Cat.No. : | POTEH-301256H |
Product Overview : | Recombinant Human POTEH protein(24-59 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-59 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | POTEH POTE ankyrin domain family, member H [ Homo sapiens ] |
Official Symbol | POTEH |
Synonyms | POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1; |
Gene ID | 23784 |
mRNA Refseq | NM_001136213 |
Protein Refseq | NP_001129685 |
MIM | 608913 |
UniProt ID | Q6S545 |
◆ Recombinant Proteins | ||
POTEH-213H | Recombinant Human POTEH Protein, GST-tagged | +Inquiry |
POTEH-301256H | Recombinant Human POTEH protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POTEH-21HCL | Recombinant Human POTEH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POTEH Products
Required fields are marked with *
My Review for All POTEH Products
Required fields are marked with *