Recombinant Human POTEH protein, GST-tagged
Cat.No. : | POTEH-301256H |
Product Overview : | Recombinant Human POTEH (24-59 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met24-Ser59 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | POTEH POTE ankyrin domain family, member H [ Homo sapiens ] |
Official Symbol | POTEH |
Synonyms | POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1; |
Gene ID | 23784 |
mRNA Refseq | NM_001136213 |
Protein Refseq | NP_001129685 |
MIM | 608913 |
UniProt ID | Q6S545 |
◆ Recombinant Proteins | ||
POTEH-301256H | Recombinant Human POTEH protein, GST-tagged | +Inquiry |
POTEH-213H | Recombinant Human POTEH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POTEH-21HCL | Recombinant Human POTEH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POTEH Products
Required fields are marked with *
My Review for All POTEH Products
Required fields are marked with *