Recombinant Human POTEH protein, GST-tagged

Cat.No. : POTEH-301256H
Product Overview : Recombinant Human POTEH protein(24-59 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-59 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name POTEH POTE ankyrin domain family, member H [ Homo sapiens ]
Official Symbol POTEH
Synonyms POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1;
Gene ID 23784
mRNA Refseq NM_001136213
Protein Refseq NP_001129685
MIM 608913
UniProt ID Q6S545

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POTEH Products

Required fields are marked with *

My Review for All POTEH Products

Required fields are marked with *

0
cart-icon
0
compare icon