Recombinant Human POU3F2 protein, Arginine-tagged
Cat.No. : | POU3F2-132H |
Product Overview : | Recombinant human POU3F2 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | GEFATAASNHYSLLTSSASIVHAEPPGGMQQGAGGY REAHSLVQGDYGALHSNGHPLSHAHQWITALSHGGGDGSPWSTSPLGQPDIKPSVVVQQGGRG DELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLP PSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPP PPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFS QTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKG ALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSR DTPPHHGVQTPVQLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for study of Neuronal cell trans-differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | POU3F2 POU class 3 homeobox 2 [ Homo sapiens ] |
Official Symbol | POU3F2 |
Synonyms | POU3F2; POU class 3 homeobox 2; BRN2; OCT7; POUF3; brain-2; OTF7; OTF-7; brn-2; oct-7; N-Oct3; |
Gene ID | 5454 |
mRNA Refseq | NM_005604 |
Protein Refseq | NP_005595 |
MIM | 600494 |
UniProt ID | P20265 |
Chromosome Location | 6q16.2 |
Pathway | SIDS Susceptibility Pathways, organism-specific biosystem; |
Function | RNA polymerase II transcription coactivator activity; identical protein binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
POU3F2-13142M | Recombinant Mouse POU3F2 Protein | +Inquiry |
POU3F2-4584R | Recombinant Rat POU3F2 Protein | +Inquiry |
POU3F2-1606H | Recombinant Human POU3F2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POU3F2-2189HFL | Recombinant Full Length Human POU3F2 Protein, C-Flag-tagged | +Inquiry |
POU3F2-1865H | Recombinant Human POU3F2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU3F2 Products
Required fields are marked with *
My Review for All POU3F2 Products
Required fields are marked with *