Recombinant Human POU3F2 protein, Arginine-tagged
| Cat.No. : | POU3F2-132H |
| Product Overview : | Recombinant human POU3F2 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | GEFATAASNHYSLLTSSASIVHAEPPGGMQQGAGGY REAHSLVQGDYGALHSNGHPLSHAHQWITALSHGGGDGSPWSTSPLGQPDIKPSVVVQQGGRG DELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLP PSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPP PPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFS QTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKG ALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSR DTPPHHGVQTPVQLEESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein transduction for study of Neuronal cell trans-differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | POU3F2 POU class 3 homeobox 2 [ Homo sapiens ] |
| Official Symbol | POU3F2 |
| Synonyms | POU3F2; POU class 3 homeobox 2; BRN2; OCT7; POUF3; brain-2; OTF7; OTF-7; brn-2; oct-7; N-Oct3; |
| Gene ID | 5454 |
| mRNA Refseq | NM_005604 |
| Protein Refseq | NP_005595 |
| MIM | 600494 |
| UniProt ID | P20265 |
| Chromosome Location | 6q16.2 |
| Pathway | SIDS Susceptibility Pathways, organism-specific biosystem; |
| Function | RNA polymerase II transcription coactivator activity; identical protein binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| Pou3f2-5020M | Recombinant Mouse Pou3f2 Protein, Myc/DDK-tagged | +Inquiry |
| POU3F2-6953M | Recombinant Mouse POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| POU3F2-132H | Recombinant Human POU3F2 protein, Arginine-tagged | +Inquiry |
| POU3F2-13142M | Recombinant Mouse POU3F2 Protein | +Inquiry |
| POU3F2-4244R | Recombinant Rat POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU3F2 Products
Required fields are marked with *
My Review for All POU3F2 Products
Required fields are marked with *



