Recombinant Human POU6F1 protein, His-tagged
Cat.No. : | POU6F1-3025H |
Product Overview : | Recombinant Human POU6F1 protein, fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | POU6F1 POU class 6 homeobox 1 [ Homo sapiens ] |
Official Symbol | POU6F1 |
Synonyms | POU6F1; POU class 6 homeobox 1; POU domain, class 6, transcription factor 1; BRN5; MPOU; TCFB1; brn-5; brain-5; mPOU homeobox protein; brain-specific homeobox/POU domain protein 5; |
Gene ID | 5463 |
mRNA Refseq | NM_002702 |
Protein Refseq | NP_002693 |
UniProt ID | Q14863 |
◆ Recombinant Proteins | ||
POU6F1-6959M | Recombinant Mouse POU6F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POU6F1-8737Z | Recombinant Zebrafish POU6F1 | +Inquiry |
POU6F1-13149M | Recombinant Mouse POU6F1 Protein | +Inquiry |
POU6F1-4247R | Recombinant Rat POU6F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POU6F1-4587R | Recombinant Rat POU6F1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU6F1-2997HCL | Recombinant Human POU6F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU6F1 Products
Required fields are marked with *
My Review for All POU6F1 Products
Required fields are marked with *