Recombinant Human POU6F1 protein, His-tagged
| Cat.No. : | POU6F1-3025H |
| Product Overview : | Recombinant Human POU6F1 protein, fused to His tag, was expressed in E. coli. |
| Availability | October 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | POU6F1 POU class 6 homeobox 1 [ Homo sapiens ] |
| Official Symbol | POU6F1 |
| Synonyms | POU6F1; POU class 6 homeobox 1; POU domain, class 6, transcription factor 1; BRN5; MPOU; TCFB1; brn-5; brain-5; mPOU homeobox protein; brain-specific homeobox/POU domain protein 5; |
| Gene ID | 5463 |
| mRNA Refseq | NM_002702 |
| Protein Refseq | NP_002693 |
| UniProt ID | Q14863 |
| ◆ Recombinant Proteins | ||
| Pou6f1-5025M | Recombinant Mouse Pou6f1 Protein, Myc/DDK-tagged | +Inquiry |
| POU6F1-640H | Recombinant Human POU6F1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| POU6F1-13149M | Recombinant Mouse POU6F1 Protein | +Inquiry |
| POU6F1-3025H | Recombinant Human POU6F1 protein, His-tagged | +Inquiry |
| POU6F1-7615H | Recombinant Human POU6F1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POU6F1-2997HCL | Recombinant Human POU6F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU6F1 Products
Required fields are marked with *
My Review for All POU6F1 Products
Required fields are marked with *
