Recombinant Human PPIH protein, T7-tagged

• Cat.No.: PPIH-219H
• Product Overview: Recombinant human PPIH fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFGSAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIG YKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWL DGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Purity: >90% by SDS-PAGE.
• Applications: 1. May be used for human spliceosome regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for enzymatic assay
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ]
• Official Symbol: PPIH
• Synonyms: PPIH; CYP 20; CYPH; MGC5016; rotamase H; SnuCyp 20; USA CYP; USA CyP SnuCyp 20; USA-CyP SnuCyp-20; CYP-20; USA-CYP; SnuCyp-20
• Gene ID: 10465
• mRNA Refseq: NM_006347
• Protein Refseq: NP_006338
• MIM: 606095
• UniProt ID: O43447
• Chromosome Location: 1p34.1
• Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem
• Function: cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding