Recombinant Human PPIH protein, T7-tagged

Cat.No. : PPIH-219H
Product Overview : Recombinant human PPIH fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIG YKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWL DGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Purity : >90% by SDS-PAGE.
Applications : 1. May be used for human spliceosome regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for enzymatic assay
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ]
Official Symbol PPIH
Synonyms PPIH; CYP 20; CYPH; MGC5016; rotamase H; SnuCyp 20; USA CYP; USA CyP SnuCyp 20; USA-CyP SnuCyp-20; CYP-20; USA-CYP; SnuCyp-20;
Gene ID 10465
mRNA Refseq NM_006347
Protein Refseq NP_006338
MIM 606095
UniProt ID O43447
Chromosome Location 1p34.1
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem;
Function cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIH Products

Required fields are marked with *

My Review for All PPIH Products

Required fields are marked with *

0
cart-icon