Recombinant Human PPIH protein, T7-tagged
| Cat.No. : | PPIH-219H |
| Product Overview : | Recombinant human PPIH fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFGSAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIG YKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWL DGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Purity : | >90% by SDS-PAGE. |
| Applications : | 1. May be used for human spliceosome regulation study in vitro,2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used for enzymatic assay |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Gene Name | PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ] |
| Official Symbol | PPIH |
| Synonyms | PPIH; CYP 20; CYPH; MGC5016; rotamase H; SnuCyp 20; USA CYP; USA CyP SnuCyp 20; USA-CyP SnuCyp-20; CYP-20; USA-CYP; SnuCyp-20; |
| Gene ID | 10465 |
| mRNA Refseq | NM_006347 |
| Protein Refseq | NP_006338 |
| MIM | 606095 |
| UniProt ID | O43447 |
| Chromosome Location | 1p34.1 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem; |
| Function | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding; |
| ◆ Recombinant Proteins | ||
| PPIH-11421Z | Recombinant Zebrafish PPIH | +Inquiry |
| PPIH-3367R | Recombinant Rhesus Macaque PPIH Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPIH-30685TH | Recombinant Human PPIH, T7 -tagged | +Inquiry |
| PPIH-219H | Recombinant Human PPIH protein, T7-tagged | +Inquiry |
| PPIH-181H | Recombinant Human PPIH Protein, HIS-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIH-2969HCL | Recombinant Human PPIH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIH Products
Required fields are marked with *
My Review for All PPIH Products
Required fields are marked with *
