Recombinant Human PPM1B protein, His-SUMO-tagged

Cat.No. : PPM1B-3365H
Product Overview : Recombinant Human PPM1B protein(O75688)(2-192aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-192aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.6 kDa
AA Sequence : SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B [ Homo sapiens ]
Official Symbol PPM1B
Synonyms PPM1B; protein phosphatase, Mg2+/Mn2+ dependent, 1B; protein phosphatase 1B (formerly 2C), magnesium dependent, beta isoform; protein phosphatase 1B; PP2CB; PP2CBETA; PPC2BETAX; protein phosphatase 2C; beta isoform; PP2C-beta; protein phosphatase 2C isoform beta; protein phosphatase 2C-like protein; protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform; PP2C-beta-X; MGC21657;
Gene ID 5495
mRNA Refseq NM_001033556
Protein Refseq NP_001028728
MIM 603770
UniProt ID O75688

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPM1B Products

Required fields are marked with *

My Review for All PPM1B Products

Required fields are marked with *

0
cart-icon