Recombinant Human PPM1D protein, His-tagged
Cat.No. : | PPM1D-2917H |
Product Overview : | Recombinant Human PPM1D protein(254-423 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 254-423 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PPM1D protein phosphatase, Mg2+/Mn2+ dependent, 1D [ Homo sapiens ] |
Official Symbol | PPM1D |
Synonyms | PPM1D; protein phosphatase, Mg2+/Mn2+ dependent, 1D; protein phosphatase 1D magnesium dependent, delta isoform; protein phosphatase 1D; PP2C DELTA; protein phosphatase 2C; delta isoform; wild type p53 induced phosphatase 1; Wip1; protein phosphatase Wip1; wild-type p53-induced phosphatase 1; protein phosphatase 2C delta isoform; protein phosphatase magnesium-dependent 1 delta; protein phosphatase 1D magnesium-dependent, delta isoform; WIP1; PP2C-DELTA; |
Gene ID | 8493 |
mRNA Refseq | NM_003620 |
Protein Refseq | NP_003611 |
MIM | 605100 |
UniProt ID | O15297 |
◆ Recombinant Proteins | ||
PPM1D-2668H | Recombinant Human PPM1D Protein, MYC/DDK-tagged | +Inquiry |
PPM1D-1744H | Recombinant Human PPM1D Protein, His (Fc)-Avi-tagged | +Inquiry |
PPM1D-3553R | Recombinant Rhesus monkey PPM1D Protein, His-tagged | +Inquiry |
PPM1D-3371R | Recombinant Rhesus Macaque PPM1D Protein, His (Fc)-Avi-tagged | +Inquiry |
PPM1D-2917H | Recombinant Human PPM1D protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPM1D Products
Required fields are marked with *
My Review for All PPM1D Products
Required fields are marked with *