Recombinant Human PPP1CB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPP1CB-5964H
Product Overview : PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Mass : 37.2 kDa
AA Sequence : MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPP1CB protein phosphatase 1 catalytic subunit beta [ Homo sapiens (human) ]
Official Symbol PPP1CB
Synonyms PPP1CB; protein phosphatase 1, catalytic subunit, beta isozyme; protein phosphatase 1, catalytic subunit, beta isoform; serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP 1B; PP1beta; protein phosphatase 1-beta; protein phosphatase 1-delta; protein phosphatase 1, catalytic subunit, delta isoform; serine/threonine protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; MGC3672;
Gene ID 5500
mRNA Refseq NM_206876
Protein Refseq NP_996759
MIM 600590
UniProt ID P62140

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1CB Products

Required fields are marked with *

My Review for All PPP1CB Products

Required fields are marked with *

0
cart-icon
0
compare icon