Recombinant Human PPP1CB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP1CB-5964H |
Product Overview : | PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP1CB protein phosphatase 1 catalytic subunit beta [ Homo sapiens (human) ] |
Official Symbol | PPP1CB |
Synonyms | PPP1CB; protein phosphatase 1, catalytic subunit, beta isozyme; protein phosphatase 1, catalytic subunit, beta isoform; serine/threonine-protein phosphatase PP1-beta catalytic subunit; PP 1B; PP1beta; protein phosphatase 1-beta; protein phosphatase 1-delta; protein phosphatase 1, catalytic subunit, delta isoform; serine/threonine protein phosphatase PP1-beta catalytic subunit; PP-1B; PPP1CD; MGC3672; |
Gene ID | 5500 |
mRNA Refseq | NM_206876 |
Protein Refseq | NP_996759 |
MIM | 600590 |
UniProt ID | P62140 |
◆ Recombinant Proteins | ||
PPP1CB-2614H | Recombinant Human PPP1CB Protein, His-tagged | +Inquiry |
Ppp1cb-5055M | Recombinant Mouse Ppp1cb Protein, Myc/DDK-tagged | +Inquiry |
PPP1CB-13210M | Recombinant Mouse PPP1CB Protein | +Inquiry |
PPP1CB-2170H | Recombinant Human PPP1CB Protein (2-327 aa), His-tagged | +Inquiry |
PPP1CB-4271R | Recombinant Rat PPP1CB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CB-2949HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
PPP1CB-2950HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1CB Products
Required fields are marked with *
My Review for All PPP1CB Products
Required fields are marked with *