Recombinant Human PPP1CC protein, His&Myc-tagged
Cat.No. : | PPP1CC-3367H |
Product Overview : | Recombinant Human PPP1CC protein(P36873)(2-323aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
Official Symbol | PPP1CC |
Synonyms | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; serine/threonine phosphatase 1 gamma; protein phosphatase 1C catalytic subunit; PP-1G; PPP1G; |
Gene ID | 5501 |
mRNA Refseq | NM_001244974 |
Protein Refseq | NP_001231903 |
MIM | 176914 |
UniProt ID | P36873 |
◆ Recombinant Proteins | ||
PPP1CC-7001M | Recombinant Mouse PPP1CC Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1CC-29101TH | Recombinant Human PPP1CC | +Inquiry |
Ppp1cc-5056M | Recombinant Mouse Ppp1cc Protein, Myc/DDK-tagged | +Inquiry |
PPP1CC-13211M | Recombinant Mouse PPP1CC Protein | +Inquiry |
PPP1CC-2401H | Recombinant Human Protein Phosphatase 1, Catalytic Subunit, Gamma Isozyme, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CC-2948HCL | Recombinant Human PPP1CC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1CC Products
Required fields are marked with *
My Review for All PPP1CC Products
Required fields are marked with *
0
Inquiry Basket