Recombinant Human PPP2CA protein, His&Myc-tagged
| Cat.No. : | PPP2CA-6786H |
| Product Overview : | Recombinant Human PPP2CA protein(P67775)(1-309aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-309aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
| Gene Name | PPP2CA protein phosphatase 2, catalytic subunit, alpha isozyme [ Homo sapiens ] |
| Official Symbol | PPP2CA |
| Synonyms | PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA; |
| Gene ID | 5515 |
| mRNA Refseq | NM_002715 |
| Protein Refseq | NP_002706 |
| MIM | 176915 |
| UniProt ID | P67775 |
| ◆ Recombinant Proteins | ||
| PPP2CA-2607Z | Recombinant Zebrafish PPP2CA | +Inquiry |
| PPP2CA-5319H | Recombinant Human PPP2CA protein | +Inquiry |
| PPP2CA-4737B | Recombinant Bovine PPP2CA protein | +Inquiry |
| PPP2CA-27617TH | Recombinant Human PPP2CA protein, GST-tagged | +Inquiry |
| PPP2CA-5317H | Recombinant Human PPP2CA protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP2CA-2929HCL | Recombinant Human PPP2CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2CA Products
Required fields are marked with *
My Review for All PPP2CA Products
Required fields are marked with *



