Recombinant Human PPP2CA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP2CA-571H |
Product Overview : | PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP2CA protein phosphatase 2 catalytic subunit alpha [ Homo sapiens (human) ] |
Official Symbol | PPP2CA |
Synonyms | PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA; |
Gene ID | 5515 |
mRNA Refseq | NM_002715 |
Protein Refseq | NP_002706 |
MIM | 176915 |
UniProt ID | P67775 |
◆ Recombinant Proteins | ||
PPP2CA-077H | Recombinant Human PPP2CA Protein, octahistidine/streptactin-tagged | +Inquiry |
PPP2CA-15H | Recombinant Human PPP2CA protein, MYC/DDK-tagged | +Inquiry |
PPP2CA-50H | Recombinant Human PPP2CA Protein, Full Length, N-GST tagged | +Inquiry |
PPP2CA-13249M | Recombinant Mouse PPP2CA Protein | +Inquiry |
PPP2CA-2607Z | Recombinant Zebrafish PPP2CA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CA-2929HCL | Recombinant Human PPP2CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2CA Products
Required fields are marked with *
My Review for All PPP2CA Products
Required fields are marked with *
0
Inquiry Basket