Recombinant Human PPP2CA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPP2CA-571H
Product Overview : PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.
Molecular Mass : 35.6 kDa
AA Sequence : MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPP2CA protein phosphatase 2 catalytic subunit alpha [ Homo sapiens (human) ]
Official Symbol PPP2CA
Synonyms PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA;
Gene ID 5515
mRNA Refseq NM_002715
Protein Refseq NP_002706
MIM 176915
UniProt ID P67775

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2CA Products

Required fields are marked with *

My Review for All PPP2CA Products

Required fields are marked with *

0
cart-icon
0
compare icon