Recombinant Human PPP2CB Protein (1-309 aa), GST-tagged

Cat.No. : PPP2CB-1178H
Product Overview : Recombinant Human PPP2CB Protein (1-309 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-309 aa
Description : PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 62.6 kDa
AA Sequence : MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ]
Official Symbol PPP2CB
Synonyms PPP2CB; PP2Abeta; beta isoform; PP2A-beta; PP2CB;
Gene ID 5516
mRNA Refseq NM_001009552
Protein Refseq NP_001009552
MIM 176916
UniProt ID P62714

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2CB Products

Required fields are marked with *

My Review for All PPP2CB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon