Recombinant Human PPP2CB Protein (1-309 aa), GST-tagged
| Cat.No. : | PPP2CB-1178H |
| Product Overview : | Recombinant Human PPP2CB Protein (1-309 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-309 aa |
| Description : | PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 62.6 kDa |
| AA Sequence : | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ] |
| Official Symbol | PPP2CB |
| Synonyms | PPP2CB; PP2Abeta; beta isoform; PP2A-beta; PP2CB; |
| Gene ID | 5516 |
| mRNA Refseq | NM_001009552 |
| Protein Refseq | NP_001009552 |
| MIM | 176916 |
| UniProt ID | P62714 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2CB Products
Required fields are marked with *
My Review for All PPP2CB Products
Required fields are marked with *
