Recombinant Human PPP2R5A
Cat.No. : | PPP2R5A-31104TH |
Product Overview : | Recombinant full length Human PPP2R5A with N-terminal proprietary tag. Predicted MW 79.57kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 486 amino acids |
Description : | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. |
Molecular Weight : | 79.570kDa inclusive of tags |
Tissue specificity : | Widely expressed with the highest expression in heart and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQG SSQFRSQGSQAELHPLPQLKDATSNEQQELFCQKLQQCCI LFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQ LVYEFFLRFLESPDFRPSIAKRYIDQKFVQQLLELFDSED PRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMH TAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPK TCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV SSSHFQVAERALYFWNNEYILSLIEENINKILPIMFASLY KISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAE RQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL SNTSAE |
Sequence Similarities : | Belongs to the phosphatase 2A regulatory subunit B56 family. |
Gene Name | PPP2R5A protein phosphatase 2, regulatory subunit B, alpha [ Homo sapiens ] |
Official Symbol | PPP2R5A |
Synonyms | PPP2R5A; protein phosphatase 2, regulatory subunit B, alpha; protein phosphatase 2, regulatory subunit B (B56), alpha isoform , protein phosphatase 2, regulatory subunit B, alpha isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit |
Gene ID | 5525 |
mRNA Refseq | NM_001199756 |
Protein Refseq | NP_001186685 |
MIM | 601643 |
Uniprot ID | Q15172 |
Chromosome Location | 1q32.2-q32.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | kinase binding; protein binding; protein phosphatase type 2A regulator activity; |
◆ Recombinant Proteins | ||
PPP2R5A-7038M | Recombinant Mouse PPP2R5A Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R5A-31104TH | Recombinant Human PPP2R5A | +Inquiry |
PPP2R5A-1919H | Recombinant Human PPP2R5A, GST-tagged | +Inquiry |
PPP2R5A-394HF | Recombinant Full Length Human PPP2R5A Protein | +Inquiry |
PPP2R5A-3392R | Recombinant Rhesus Macaque PPP2R5A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R5A-1404HCL | Recombinant Human PPP2R5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2R5A Products
Required fields are marked with *
My Review for All PPP2R5A Products
Required fields are marked with *
0
Inquiry Basket