Recombinant Human PRDX2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRDX2-697H |
Product Overview : | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_859428) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVISITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRDX2 peroxiredoxin 2 [ Homo sapiens (human) ] |
Official Symbol | PRDX2 |
Synonyms | PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1; |
Gene ID | 7001 |
mRNA Refseq | NM_181738 |
Protein Refseq | NP_859428 |
MIM | 600538 |
UniProt ID | P32119 |
◆ Recombinant Proteins | ||
Prdx2-5102M | Recombinant Mouse Prdx2 Protein, Myc/DDK-tagged | +Inquiry |
PRDX2-336H | Recombinant Human PRDX2 protein, GST-tagged | +Inquiry |
PRDX2-503H | Recombinant Human Peroxiredoxin 2, His-tagged | +Inquiry |
PRDX2-598Z | Recombinant Zebrafish PRDX2 | +Inquiry |
PRDX2-333H | Recombinant Human PRDX2 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX2-564HCL | Recombinant Human PRDX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRDX2 Products
Required fields are marked with *
My Review for All PRDX2 Products
Required fields are marked with *
0
Inquiry Basket