Recombinant Human PRDX4 protein(71-260 aa), C-His-tagged
| Cat.No. : | PRDX4-2845H |
| Product Overview : | Recombinant Human PRDX4 protein(Q13162)(71-260 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71-260 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDP |
| Gene Name | PRDX4 peroxiredoxin 4 [ Homo sapiens ] |
| Official Symbol | PRDX4 |
| Synonyms | PRDX4; peroxiredoxin 4; peroxiredoxin-4; AOE37 2; prx-IV; peroxiredoxin IV; antioxidant enzyme AOE372; thioredoxin peroxidase AO372; thioredoxin peroxidase (antioxidant enzyme); thioredoxin-dependent peroxide reductase A0372; PRX-4; AOE37-2; |
| Gene ID | 10549 |
| mRNA Refseq | NM_006406 |
| Protein Refseq | NP_006397 |
| MIM | 606506 |
| UniProt ID | Q13162 |
| ◆ Recombinant Proteins | ||
| PRDX4-322H | Recombinant Human PRDX4 Protein, His-tagged | +Inquiry |
| PRDX4-1022H | Recombinant Human PRDX4 | +Inquiry |
| PRDX4-3910H | Recombinant Human PRDX4 Protein (Trp38-Asn271), N-His tagged | +Inquiry |
| PRDX4-13325M | Recombinant Mouse PRDX4 Protein | +Inquiry |
| PRDX4-5551Z | Recombinant Zebrafish PRDX4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRDX4-400HKCL | Human PRDX4 Knockdown Cell Lysate | +Inquiry |
| PRDX4-2880HCL | Recombinant Human PRDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX4 Products
Required fields are marked with *
My Review for All PRDX4 Products
Required fields are marked with *
