Recombinant Human PRDX4 protein(71-260 aa), C-His-tagged

• Cat.No.: PRDX4-2845H
• Product Overview: Recombinant Human PRDX4 protein(Q13162)(71-260 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 71-260 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDP

Gene Information

• Gene Name: PRDX4 peroxiredoxin 4 [ Homo sapiens ]
• Official Symbol: PRDX4
• Synonyms: PRDX4; peroxiredoxin 4; peroxiredoxin-4; AOE37 2; prx-IV; peroxiredoxin IV; antioxidant enzyme AOE372; thioredoxin peroxidase AO372; thioredoxin peroxidase (antioxidant enzyme); thioredoxin-dependent peroxide reductase A0372; PRX-4; AOE37-2
• Gene ID: 10549
• mRNA Refseq: NM_006406
• Protein Refseq: NP_006397
• MIM: 606506
• UniProt ID: Q13162