Recombinant Human PRDX4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRDX4-700H
Product Overview : PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.
Molecular Mass : 30.5 kDa
AA Sequence : MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRDX4 peroxiredoxin 4 [ Homo sapiens (human) ]
Official Symbol PRDX4
Synonyms PRDX4; peroxiredoxin 4; peroxiredoxin-4; AOE37 2; prx-IV; peroxiredoxin IV; antioxidant enzyme AOE372; thioredoxin peroxidase AO372; thioredoxin peroxidase (antioxidant enzyme); thioredoxin-dependent peroxide reductase A0372; PRX-4; AOE37-2;
Gene ID 10549
mRNA Refseq NM_006406
Protein Refseq NP_006397
MIM 606506
UniProt ID Q13162

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX4 Products

Required fields are marked with *

My Review for All PRDX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon