Recombinant Human PRDX4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRDX4-700H |
Product Overview : | PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRDX4 peroxiredoxin 4 [ Homo sapiens (human) ] |
Official Symbol | PRDX4 |
Synonyms | PRDX4; peroxiredoxin 4; peroxiredoxin-4; AOE37 2; prx-IV; peroxiredoxin IV; antioxidant enzyme AOE372; thioredoxin peroxidase AO372; thioredoxin peroxidase (antioxidant enzyme); thioredoxin-dependent peroxide reductase A0372; PRX-4; AOE37-2; |
Gene ID | 10549 |
mRNA Refseq | NM_006406 |
Protein Refseq | NP_006397 |
MIM | 606506 |
UniProt ID | Q13162 |
◆ Recombinant Proteins | ||
Prdx4-7544M | Recombinant Mouse Prdx4 protein, His-tagged | +Inquiry |
PRDX4-3910H | Recombinant Human PRDX4 Protein (Trp38-Asn271), N-His tagged | +Inquiry |
PRDX4-2845H | Recombinant Human PRDX4 protein(71-260 aa), C-His-tagged | +Inquiry |
PRDX4-3410R | Recombinant Rhesus Macaque PRDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prdx4-323M | Recombinant Mouse Prdx4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX4-2880HCL | Recombinant Human PRDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX4 Products
Required fields are marked with *
My Review for All PRDX4 Products
Required fields are marked with *
0
Inquiry Basket