Recombinant Human PRELP

Cat.No. : PRELP-30073TH
Product Overview : Recombinant fragment corresponding to amino acids 281-365 of Human PRELP, with a N terminal proprietary tag; predicted MW: 34.98 kDa inclusive of tag. P51888,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 85 amino acids
Description : The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed.
Molecular Weight : 34.980kDa inclusive of tags
Tissue specificity : Connective tissue.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP
Sequence Similarities : Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.Contains 12 LRR (leucine-rich) repeats.
Gene Name PRELP proline/arginine-rich end leucine-rich repeat protein [ Homo sapiens ]
Official Symbol PRELP
Synonyms PRELP; proline/arginine-rich end leucine-rich repeat protein; proline arginine rich end leucine rich repeat protein; prolargin; prolargin proteoglycan; SLRR2A;
Gene ID 5549
mRNA Refseq NM_002725
Protein Refseq NP_002716
MIM 601914
Uniprot ID P51888
Chromosome Location 1q32
Function extracellular matrix structural constituent; heparin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRELP Products

Required fields are marked with *

My Review for All PRELP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon